Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   JN057_RS02705 Genome accession   NZ_CP071871
Coordinates   512257..512406 (+) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain BVJ1JL     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 507257..517406
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JN057_RS02680 (JN057_00554) blpC 507521..507676 (-) 156 WP_000358812.1 quorum-sensing system pheromone BlpC -
  JN057_RS02685 (JN057_00555) - 507733..509094 (-) 1362 WP_001069063.1 bacteriocin secretion accessory protein -
  JN057_RS02690 (JN057_00556) comA/nlmT 509105..511258 (-) 2154 WP_000205159.1 peptide cleavage/export ABC transporter BlpA Regulator
  JN057_RS02695 (JN057_00557) blpM 511540..511794 (+) 255 WP_001093255.1 two-peptide bacteriocin subunit BlpM -
  JN057_RS02700 (JN057_00558) blpN 511810..512013 (+) 204 WP_001099490.1 two-peptide bacteriocin subunit BlpN -
  JN057_RS02705 cipB 512257..512406 (+) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  JN057_RS02710 - 512510..512629 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  JN057_RS02715 (JN057_00560) - 513110..513468 (+) 359 Protein_540 immunity protein -
  JN057_RS02720 (JN057_00561) - 514097..514480 (+) 384 WP_000877381.1 hypothetical protein -
  JN057_RS02725 (JN057_00562) - 514532..515221 (+) 690 WP_000760532.1 CPBP family intramembrane glutamic endopeptidase -
  JN057_RS02730 (JN057_00563) blpZ 515263..515496 (+) 234 WP_000276498.1 immunity protein BlpZ -
  JN057_RS02735 (JN057_00564) - 515647..516258 (+) 612 WP_000394044.1 CPBP family intramembrane glutamic endopeptidase -
  JN057_RS02740 (JN057_00565) ccrZ 516419..517213 (+) 795 WP_000363002.1 cell cycle regulator CcrZ -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=548606 JN057_RS02705 WP_001809846.1 512257..512406(+) (cipB) [Streptococcus pneumoniae strain BVJ1JL]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=548606 JN057_RS02705 WP_001809846.1 512257..512406(+) (cipB) [Streptococcus pneumoniae strain BVJ1JL]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531