Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   LOZ87_RS14700 Genome accession   NZ_CP087391
Coordinates   3009168..3009308 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain ZF57     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3004168..3014308
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LOZ87_RS14675 (LOZ87_14675) - 3004464..3004847 (-) 384 WP_007408674.1 hotdog fold thioesterase -
  LOZ87_RS14680 (LOZ87_14680) comA 3004869..3005513 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  LOZ87_RS14685 (LOZ87_14685) comP 3005594..3007903 (-) 2310 WP_033574914.1 histidine kinase Regulator
  LOZ87_RS14690 (LOZ87_14690) comX 3007923..3008099 (-) 177 WP_007408675.1 competence pheromone ComX Regulator
  LOZ87_RS14695 (LOZ87_14695) comQ 3008099..3009037 (-) 939 WP_020954300.1 polyprenyl synthetase family protein Regulator
  LOZ87_RS14700 (LOZ87_14700) degQ 3009168..3009308 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  LOZ87_RS14705 (LOZ87_14705) - 3009774..3010115 (+) 342 WP_015418107.1 hypothetical protein -
  LOZ87_RS14710 (LOZ87_14710) - 3010122..3011345 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  LOZ87_RS14715 (LOZ87_14715) - 3011475..3012941 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  LOZ87_RS14720 (LOZ87_14720) - 3012959..3013510 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  LOZ87_RS14725 (LOZ87_14725) - 3013607..3014005 (-) 399 WP_003152031.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=546027 LOZ87_RS14700 WP_003152043.1 3009168..3009308(-) (degQ) [Bacillus amyloliquefaciens strain ZF57]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=546027 LOZ87_RS14700 WP_003152043.1 3009168..3009308(-) (degQ) [Bacillus amyloliquefaciens strain ZF57]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891