Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | LOZ87_RS14700 | Genome accession | NZ_CP087391 |
| Coordinates | 3009168..3009308 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus amyloliquefaciens strain ZF57 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3004168..3014308
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LOZ87_RS14675 (LOZ87_14675) | - | 3004464..3004847 (-) | 384 | WP_007408674.1 | hotdog fold thioesterase | - |
| LOZ87_RS14680 (LOZ87_14680) | comA | 3004869..3005513 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| LOZ87_RS14685 (LOZ87_14685) | comP | 3005594..3007903 (-) | 2310 | WP_033574914.1 | histidine kinase | Regulator |
| LOZ87_RS14690 (LOZ87_14690) | comX | 3007923..3008099 (-) | 177 | WP_007408675.1 | competence pheromone ComX | Regulator |
| LOZ87_RS14695 (LOZ87_14695) | comQ | 3008099..3009037 (-) | 939 | WP_020954300.1 | polyprenyl synthetase family protein | Regulator |
| LOZ87_RS14700 (LOZ87_14700) | degQ | 3009168..3009308 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| LOZ87_RS14705 (LOZ87_14705) | - | 3009774..3010115 (+) | 342 | WP_015418107.1 | hypothetical protein | - |
| LOZ87_RS14710 (LOZ87_14710) | - | 3010122..3011345 (-) | 1224 | WP_007408678.1 | EAL and HDOD domain-containing protein | - |
| LOZ87_RS14715 (LOZ87_14715) | - | 3011475..3012941 (-) | 1467 | WP_020954301.1 | nicotinate phosphoribosyltransferase | - |
| LOZ87_RS14720 (LOZ87_14720) | - | 3012959..3013510 (-) | 552 | WP_003152033.1 | cysteine hydrolase family protein | - |
| LOZ87_RS14725 (LOZ87_14725) | - | 3013607..3014005 (-) | 399 | WP_003152031.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=546027 LOZ87_RS14700 WP_003152043.1 3009168..3009308(-) (degQ) [Bacillus amyloliquefaciens strain ZF57]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=546027 LOZ87_RS14700 WP_003152043.1 3009168..3009308(-) (degQ) [Bacillus amyloliquefaciens strain ZF57]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |