Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   JWY36_RS12695 Genome accession   NZ_CP071276
Coordinates   2361043..2361426 (-) Length   127 a.a.
NCBI ID   WP_014480254.1    Uniprot ID   -
Organism   Bacillus subtilis strain JNFE0126     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2356043..2366426
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JWY36_RS12655 (JWY36_12545) sinI 2356977..2357150 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  JWY36_RS12660 (JWY36_12550) sinR 2357184..2357519 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  JWY36_RS12665 (JWY36_12555) tasA 2357612..2358397 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  JWY36_RS12670 (JWY36_12560) sipW 2358461..2359033 (-) 573 WP_003230181.1 signal peptidase I SipW -
  JWY36_RS12675 (JWY36_12565) tapA 2359017..2359778 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  JWY36_RS12680 (JWY36_12570) yqzG 2360050..2360376 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  JWY36_RS12685 (JWY36_12575) spoIITA 2360418..2360597 (-) 180 WP_014480252.1 YqzE family protein -
  JWY36_RS12690 (JWY36_12580) comGG 2360668..2361042 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  JWY36_RS12695 (JWY36_12585) comGF 2361043..2361426 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  JWY36_RS12700 (JWY36_12590) comGE 2361452..2361799 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  JWY36_RS12705 (JWY36_12595) comGD 2361783..2362214 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  JWY36_RS12710 (JWY36_12600) comGC 2362204..2362500 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  JWY36_RS12715 (JWY36_12605) comGB 2362514..2363551 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  JWY36_RS12720 (JWY36_12610) comGA 2363538..2364608 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  JWY36_RS12725 (JWY36_12615) - 2364820..2365017 (-) 198 WP_014480259.1 CBS domain-containing protein -
  JWY36_RS12730 (JWY36_12620) corA 2365019..2365972 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14329.42 Da        Isoelectric Point: 5.8949

>NTDB_id=544500 JWY36_RS12695 WP_014480254.1 2361043..2361426(-) (comGF) [Bacillus subtilis strain JNFE0126]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=544500 JWY36_RS12695 WP_014480254.1 2361043..2361426(-) (comGF) [Bacillus subtilis strain JNFE0126]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984