Detailed information    

insolico Bioinformatically predicted

Overview


Name   abrB   Type   Regulator
Locus tag   JYG31_RS00245 Genome accession   NZ_CP070976
Coordinates   44343..44633 (-) Length   96 a.a.
NCBI ID   WP_003226760.1    Uniprot ID   A0A7G9PCZ4
Organism   Bacillus halotolerans strain MBH1     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1533..68010 44343..44633 within 0


Gene organization within MGE regions


Location: 1533..68010
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JYG31_RS00010 (JYG31_00010) dnaN 1533..2669 (+) 1137 WP_024123581.1 DNA polymerase III subunit beta -
  JYG31_RS00015 (JYG31_00015) rlbA 2801..3016 (+) 216 WP_003219264.1 ribosome maturation protein RlbA -
  JYG31_RS00020 (JYG31_00020) recF 3032..4144 (+) 1113 WP_024123582.1 DNA replication/repair protein RecF Machinery gene
  JYG31_RS00025 (JYG31_00025) remB 4162..4407 (+) 246 WP_024123583.1 extracellular matrix regulator RemB -
  JYG31_RS00030 (JYG31_00030) gyrB 4463..6379 (+) 1917 WP_024123584.1 DNA topoisomerase (ATP-hydrolyzing) subunit B -
  JYG31_RS00035 (JYG31_00035) gyrA 6591..9062 (+) 2472 WP_213418216.1 DNA topoisomerase (ATP-hydrolyzing) subunit A -
  JYG31_RS00065 (JYG31_00065) - 14382..15332 (-) 951 WP_213418697.1 YaaC family protein -
  JYG31_RS00070 (JYG31_00070) guaB 15453..16919 (+) 1467 WP_024123587.1 IMP dehydrogenase -
  JYG31_RS00075 (JYG31_00075) dacA 17074..18405 (+) 1332 WP_024123588.1 D-alanyl-D-alanine carboxypeptidase -
  JYG31_RS00080 (JYG31_00080) pdxS 18602..19486 (+) 885 WP_024123589.1 pyridoxal 5'-phosphate synthase lyase subunit PdxS -
  JYG31_RS00085 (JYG31_00085) pdxT 19507..20097 (+) 591 WP_024123590.1 pyridoxal 5'-phosphate synthase glutaminase subunit PdxT -
  JYG31_RS00090 (JYG31_00090) serS 20429..21706 (+) 1278 WP_213418217.1 serine--tRNA ligase -
  JYG31_RS00100 (JYG31_00100) dck 22046..22699 (-) 654 WP_024123592.1 deoxyadenosine/deoxycytidine kinase -
  JYG31_RS00105 (JYG31_00105) dgk 22696..23319 (-) 624 WP_044153628.1 deoxyguanosine kinase -
  JYG31_RS00110 (JYG31_00110) - 23418..24701 (-) 1284 WP_103672612.1 glycoside hydrolase family 18 protein -
  JYG31_RS00115 (JYG31_00115) - 24764..25315 (-) 552 WP_024123595.1 isochorismatase family cysteine hydrolase -
  JYG31_RS00120 (JYG31_00120) tadA 25399..25884 (+) 486 WP_024123596.1 tRNA adenosine(34) deaminase TadA -
  JYG31_RS00130 (JYG31_00130) dnaX 26360..28054 (+) 1695 WP_024123597.1 DNA polymerase III subunit gamma/tau -
  JYG31_RS00135 (JYG31_00135) - 28078..28401 (+) 324 WP_014112282.1 YbaB/EbfC family nucleoid-associated protein -
  JYG31_RS00140 (JYG31_00140) recR 28416..29012 (+) 597 WP_024123598.1 recombination protein RecR -
  JYG31_RS00145 (JYG31_00145) - 29031..29255 (+) 225 WP_024123599.1 YaaL family protein -
  JYG31_RS00150 (JYG31_00150) bofA 29322..29585 (+) 264 WP_024123600.1 sigma-K factor-processing regulator BofA -
  JYG31_RS00180 (JYG31_00180) - 35005..35199 (+) 195 WP_213418218.1 sigma factor G inhibitor Gin -
  JYG31_RS00185 (JYG31_00185) - 35341..35955 (+) 615 WP_213418698.1 5-bromo-4-chloroindolyl phosphate hydrolysis family protein -
  JYG31_RS00190 (JYG31_00190) - 35973..37130 (+) 1158 WP_213418219.1 toxic anion resistance protein -
  JYG31_RS00195 (JYG31_00195) - 37214..38653 (+) 1440 WP_213418220.1 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme -
  JYG31_RS00200 (JYG31_00200) tmk 38650..39288 (+) 639 WP_101860946.1 dTMP kinase -
  JYG31_RS00205 (JYG31_00205) darA 39363..39692 (+) 330 WP_003218295.1 cyclic di-AMP receptor DarA -
  JYG31_RS00210 (JYG31_00210) - 39705..40145 (+) 441 WP_024123606.1 YaaR family protein -
  JYG31_RS00215 (JYG31_00215) holB 40157..41146 (+) 990 WP_095714727.1 DNA polymerase III subunit delta' -
  JYG31_RS00220 (JYG31_00220) ricT 41149..41976 (+) 828 WP_010332686.1 competence/sporulation regulator complex protein RicT -
  JYG31_RS00225 (JYG31_00225) yabA 41991..42350 (+) 360 WP_010332687.1 replication initiation-control protein YabA -
  JYG31_RS00230 (JYG31_00230) - 42411..43154 (+) 744 WP_069487697.1 tRNA1(Val) (adenine(37)-N6)-methyltransferase -
  JYG31_RS00235 (JYG31_00235) - 43141..43440 (+) 300 WP_010332689.1 GIY-YIG nuclease family protein -
  JYG31_RS00240 (JYG31_00240) rsmI 43415..44293 (+) 879 WP_103672539.1 16S rRNA (cytidine(1402)-2'-O)-methyltransferase -
  JYG31_RS00245 (JYG31_00245) abrB 44343..44633 (-) 291 WP_003226760.1 transition state genes transcriptional regulator AbrB Regulator
  JYG31_RS00250 (JYG31_00250) metG 45130..47124 (+) 1995 WP_024123610.1 methionine--tRNA ligase -
  JYG31_RS00255 (JYG31_00255) - 47203..47970 (+) 768 WP_069487699.1 TatD family hydrolase -
  JYG31_RS00260 (JYG31_00260) - 48216..49439 (+) 1224 WP_249746144.1 G5 and 3D domain-containing protein -
  JYG31_RS00265 (JYG31_00265) rnmV 49584..50144 (+) 561 WP_044153503.1 ribonuclease M5 -
  JYG31_RS00270 (JYG31_00270) rsmA 50137..51015 (+) 879 WP_213418222.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
  JYG31_RS00275 (JYG31_00275) prtG 51177..52049 (+) 873 WP_024123615.1 sporulation-specific protease PrtG -
  JYG31_RS00280 (JYG31_00280) - 52251..52511 (+) 261 WP_024123616.1 Veg family protein -
  JYG31_RS00285 (JYG31_00285) - 52673..52858 (+) 186 WP_010332697.1 small, acid-soluble spore protein, alpha/beta type -
  JYG31_RS00290 (JYG31_00290) ispE 53006..53875 (+) 870 WP_105992094.1 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase -
  JYG31_RS00295 (JYG31_00295) purR 53931..54788 (+) 858 WP_024123618.1 pur operon repressor -
  JYG31_RS00300 (JYG31_00300) ridA 54785..55162 (+) 378 WP_003226738.1 2-iminobutanoate/2-iminopropanoate deaminase -
  JYG31_RS00305 (JYG31_00305) spoVG 55357..55650 (+) 294 WP_003218346.1 septation regulator SpoVG -
  JYG31_RS00310 (JYG31_00310) glmU 55842..57212 (+) 1371 WP_213418223.1 bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU -
  JYG31_RS00315 (JYG31_00315) - 57235..58188 (+) 954 WP_003218353.1 ribose-phosphate diphosphokinase -
  JYG31_RS00320 (JYG31_00320) - 58273..58890 (+) 618 WP_024123620.1 50S ribosomal protein L25/general stress protein Ctc -
  JYG31_RS00325 (JYG31_00325) pth 58996..59562 (+) 567 WP_024123621.1 aminoacyl-tRNA hydrolase -
  JYG31_RS00330 (JYG31_00330) - 59623..59853 (+) 231 WP_024123622.1 anti-sigma-F factor Fin family protein -
  JYG31_RS00335 (JYG31_00335) mfd 59923..63456 (+) 3534 WP_024123623.1 transcription-repair coupling factor -
  JYG31_RS00340 (JYG31_00340) spoVT 63592..64128 (+) 537 WP_024123624.1 stage V sporulation protein T -
  JYG31_RS00345 (JYG31_00345) - 64310..65908 (+) 1599 WP_101860941.1 polysaccharide biosynthesis protein -
  JYG31_RS00350 (JYG31_00350) mazG 65898..67367 (+) 1470 WP_095714734.1 nucleoside triphosphate pyrophosphohydrolase -
  JYG31_RS00355 (JYG31_00355) - 67369..67629 (+) 261 WP_024123627.1 RNA-binding S4 domain-containing protein -
  JYG31_RS00360 (JYG31_00360) yabP 67708..68010 (+) 303 WP_024123628.1 sporulation protein YabP -

Sequence


Protein


Download         Length: 96 a.a.        Molecular weight: 10772.62 Da        Isoelectric Point: 6.3482

>NTDB_id=541698 JYG31_RS00245 WP_003226760.1 44343..44633(-) (abrB) [Bacillus halotolerans strain MBH1]
MFMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTCQVTGEVSDDNLKLAGGKLVLSKEG
AEQIISEIQNQLQNLK

Nucleotide


Download         Length: 291 bp        

>NTDB_id=541698 JYG31_RS00245 WP_003226760.1 44343..44633(-) (abrB) [Bacillus halotolerans strain MBH1]
ATGTTTATGAAATCTACTGGTATTGTACGTAAAGTTGATGAATTAGGACGTGTAGTGATTCCTATCGAACTGCGTCGTAC
TCTTGGAATCGCAGAAAAAGATGCTCTTGAAATTTATGTTGATGATGAAAAAATCATCCTTAAAAAATATAAACCAAACA
TGACTTGCCAAGTAACTGGTGAAGTTTCTGACGATAACCTTAAACTTGCTGGCGGCAAATTGGTACTAAGCAAAGAAGGC
GCTGAGCAAATCATCAGCGAAATCCAAAACCAGCTTCAAAACCTTAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A7G9PCZ4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

100

100

1