Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | JYG31_RS00245 | Genome accession | NZ_CP070976 |
| Coordinates | 44343..44633 (-) | Length | 96 a.a. |
| NCBI ID | WP_003226760.1 | Uniprot ID | A0A7G9PCZ4 |
| Organism | Bacillus halotolerans strain MBH1 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1533..68010 | 44343..44633 | within | 0 |
Gene organization within MGE regions
Location: 1533..68010
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JYG31_RS00010 (JYG31_00010) | dnaN | 1533..2669 (+) | 1137 | WP_024123581.1 | DNA polymerase III subunit beta | - |
| JYG31_RS00015 (JYG31_00015) | rlbA | 2801..3016 (+) | 216 | WP_003219264.1 | ribosome maturation protein RlbA | - |
| JYG31_RS00020 (JYG31_00020) | recF | 3032..4144 (+) | 1113 | WP_024123582.1 | DNA replication/repair protein RecF | Machinery gene |
| JYG31_RS00025 (JYG31_00025) | remB | 4162..4407 (+) | 246 | WP_024123583.1 | extracellular matrix regulator RemB | - |
| JYG31_RS00030 (JYG31_00030) | gyrB | 4463..6379 (+) | 1917 | WP_024123584.1 | DNA topoisomerase (ATP-hydrolyzing) subunit B | - |
| JYG31_RS00035 (JYG31_00035) | gyrA | 6591..9062 (+) | 2472 | WP_213418216.1 | DNA topoisomerase (ATP-hydrolyzing) subunit A | - |
| JYG31_RS00065 (JYG31_00065) | - | 14382..15332 (-) | 951 | WP_213418697.1 | YaaC family protein | - |
| JYG31_RS00070 (JYG31_00070) | guaB | 15453..16919 (+) | 1467 | WP_024123587.1 | IMP dehydrogenase | - |
| JYG31_RS00075 (JYG31_00075) | dacA | 17074..18405 (+) | 1332 | WP_024123588.1 | D-alanyl-D-alanine carboxypeptidase | - |
| JYG31_RS00080 (JYG31_00080) | pdxS | 18602..19486 (+) | 885 | WP_024123589.1 | pyridoxal 5'-phosphate synthase lyase subunit PdxS | - |
| JYG31_RS00085 (JYG31_00085) | pdxT | 19507..20097 (+) | 591 | WP_024123590.1 | pyridoxal 5'-phosphate synthase glutaminase subunit PdxT | - |
| JYG31_RS00090 (JYG31_00090) | serS | 20429..21706 (+) | 1278 | WP_213418217.1 | serine--tRNA ligase | - |
| JYG31_RS00100 (JYG31_00100) | dck | 22046..22699 (-) | 654 | WP_024123592.1 | deoxyadenosine/deoxycytidine kinase | - |
| JYG31_RS00105 (JYG31_00105) | dgk | 22696..23319 (-) | 624 | WP_044153628.1 | deoxyguanosine kinase | - |
| JYG31_RS00110 (JYG31_00110) | - | 23418..24701 (-) | 1284 | WP_103672612.1 | glycoside hydrolase family 18 protein | - |
| JYG31_RS00115 (JYG31_00115) | - | 24764..25315 (-) | 552 | WP_024123595.1 | isochorismatase family cysteine hydrolase | - |
| JYG31_RS00120 (JYG31_00120) | tadA | 25399..25884 (+) | 486 | WP_024123596.1 | tRNA adenosine(34) deaminase TadA | - |
| JYG31_RS00130 (JYG31_00130) | dnaX | 26360..28054 (+) | 1695 | WP_024123597.1 | DNA polymerase III subunit gamma/tau | - |
| JYG31_RS00135 (JYG31_00135) | - | 28078..28401 (+) | 324 | WP_014112282.1 | YbaB/EbfC family nucleoid-associated protein | - |
| JYG31_RS00140 (JYG31_00140) | recR | 28416..29012 (+) | 597 | WP_024123598.1 | recombination protein RecR | - |
| JYG31_RS00145 (JYG31_00145) | - | 29031..29255 (+) | 225 | WP_024123599.1 | YaaL family protein | - |
| JYG31_RS00150 (JYG31_00150) | bofA | 29322..29585 (+) | 264 | WP_024123600.1 | sigma-K factor-processing regulator BofA | - |
| JYG31_RS00180 (JYG31_00180) | - | 35005..35199 (+) | 195 | WP_213418218.1 | sigma factor G inhibitor Gin | - |
| JYG31_RS00185 (JYG31_00185) | - | 35341..35955 (+) | 615 | WP_213418698.1 | 5-bromo-4-chloroindolyl phosphate hydrolysis family protein | - |
| JYG31_RS00190 (JYG31_00190) | - | 35973..37130 (+) | 1158 | WP_213418219.1 | toxic anion resistance protein | - |
| JYG31_RS00195 (JYG31_00195) | - | 37214..38653 (+) | 1440 | WP_213418220.1 | aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | - |
| JYG31_RS00200 (JYG31_00200) | tmk | 38650..39288 (+) | 639 | WP_101860946.1 | dTMP kinase | - |
| JYG31_RS00205 (JYG31_00205) | darA | 39363..39692 (+) | 330 | WP_003218295.1 | cyclic di-AMP receptor DarA | - |
| JYG31_RS00210 (JYG31_00210) | - | 39705..40145 (+) | 441 | WP_024123606.1 | YaaR family protein | - |
| JYG31_RS00215 (JYG31_00215) | holB | 40157..41146 (+) | 990 | WP_095714727.1 | DNA polymerase III subunit delta' | - |
| JYG31_RS00220 (JYG31_00220) | ricT | 41149..41976 (+) | 828 | WP_010332686.1 | competence/sporulation regulator complex protein RicT | - |
| JYG31_RS00225 (JYG31_00225) | yabA | 41991..42350 (+) | 360 | WP_010332687.1 | replication initiation-control protein YabA | - |
| JYG31_RS00230 (JYG31_00230) | - | 42411..43154 (+) | 744 | WP_069487697.1 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | - |
| JYG31_RS00235 (JYG31_00235) | - | 43141..43440 (+) | 300 | WP_010332689.1 | GIY-YIG nuclease family protein | - |
| JYG31_RS00240 (JYG31_00240) | rsmI | 43415..44293 (+) | 879 | WP_103672539.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
| JYG31_RS00245 (JYG31_00245) | abrB | 44343..44633 (-) | 291 | WP_003226760.1 | transition state genes transcriptional regulator AbrB | Regulator |
| JYG31_RS00250 (JYG31_00250) | metG | 45130..47124 (+) | 1995 | WP_024123610.1 | methionine--tRNA ligase | - |
| JYG31_RS00255 (JYG31_00255) | - | 47203..47970 (+) | 768 | WP_069487699.1 | TatD family hydrolase | - |
| JYG31_RS00260 (JYG31_00260) | - | 48216..49439 (+) | 1224 | WP_249746144.1 | G5 and 3D domain-containing protein | - |
| JYG31_RS00265 (JYG31_00265) | rnmV | 49584..50144 (+) | 561 | WP_044153503.1 | ribonuclease M5 | - |
| JYG31_RS00270 (JYG31_00270) | rsmA | 50137..51015 (+) | 879 | WP_213418222.1 | 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA | - |
| JYG31_RS00275 (JYG31_00275) | prtG | 51177..52049 (+) | 873 | WP_024123615.1 | sporulation-specific protease PrtG | - |
| JYG31_RS00280 (JYG31_00280) | - | 52251..52511 (+) | 261 | WP_024123616.1 | Veg family protein | - |
| JYG31_RS00285 (JYG31_00285) | - | 52673..52858 (+) | 186 | WP_010332697.1 | small, acid-soluble spore protein, alpha/beta type | - |
| JYG31_RS00290 (JYG31_00290) | ispE | 53006..53875 (+) | 870 | WP_105992094.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
| JYG31_RS00295 (JYG31_00295) | purR | 53931..54788 (+) | 858 | WP_024123618.1 | pur operon repressor | - |
| JYG31_RS00300 (JYG31_00300) | ridA | 54785..55162 (+) | 378 | WP_003226738.1 | 2-iminobutanoate/2-iminopropanoate deaminase | - |
| JYG31_RS00305 (JYG31_00305) | spoVG | 55357..55650 (+) | 294 | WP_003218346.1 | septation regulator SpoVG | - |
| JYG31_RS00310 (JYG31_00310) | glmU | 55842..57212 (+) | 1371 | WP_213418223.1 | bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU | - |
| JYG31_RS00315 (JYG31_00315) | - | 57235..58188 (+) | 954 | WP_003218353.1 | ribose-phosphate diphosphokinase | - |
| JYG31_RS00320 (JYG31_00320) | - | 58273..58890 (+) | 618 | WP_024123620.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| JYG31_RS00325 (JYG31_00325) | pth | 58996..59562 (+) | 567 | WP_024123621.1 | aminoacyl-tRNA hydrolase | - |
| JYG31_RS00330 (JYG31_00330) | - | 59623..59853 (+) | 231 | WP_024123622.1 | anti-sigma-F factor Fin family protein | - |
| JYG31_RS00335 (JYG31_00335) | mfd | 59923..63456 (+) | 3534 | WP_024123623.1 | transcription-repair coupling factor | - |
| JYG31_RS00340 (JYG31_00340) | spoVT | 63592..64128 (+) | 537 | WP_024123624.1 | stage V sporulation protein T | - |
| JYG31_RS00345 (JYG31_00345) | - | 64310..65908 (+) | 1599 | WP_101860941.1 | polysaccharide biosynthesis protein | - |
| JYG31_RS00350 (JYG31_00350) | mazG | 65898..67367 (+) | 1470 | WP_095714734.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| JYG31_RS00355 (JYG31_00355) | - | 67369..67629 (+) | 261 | WP_024123627.1 | RNA-binding S4 domain-containing protein | - |
| JYG31_RS00360 (JYG31_00360) | yabP | 67708..68010 (+) | 303 | WP_024123628.1 | sporulation protein YabP | - |
Sequence
Protein
Download Length: 96 a.a. Molecular weight: 10772.62 Da Isoelectric Point: 6.3482
>NTDB_id=541698 JYG31_RS00245 WP_003226760.1 44343..44633(-) (abrB) [Bacillus halotolerans strain MBH1]
MFMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTCQVTGEVSDDNLKLAGGKLVLSKEG
AEQIISEIQNQLQNLK
MFMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTCQVTGEVSDDNLKLAGGKLVLSKEG
AEQIISEIQNQLQNLK
Nucleotide
Download Length: 291 bp
>NTDB_id=541698 JYG31_RS00245 WP_003226760.1 44343..44633(-) (abrB) [Bacillus halotolerans strain MBH1]
ATGTTTATGAAATCTACTGGTATTGTACGTAAAGTTGATGAATTAGGACGTGTAGTGATTCCTATCGAACTGCGTCGTAC
TCTTGGAATCGCAGAAAAAGATGCTCTTGAAATTTATGTTGATGATGAAAAAATCATCCTTAAAAAATATAAACCAAACA
TGACTTGCCAAGTAACTGGTGAAGTTTCTGACGATAACCTTAAACTTGCTGGCGGCAAATTGGTACTAAGCAAAGAAGGC
GCTGAGCAAATCATCAGCGAAATCCAAAACCAGCTTCAAAACCTTAAATAA
ATGTTTATGAAATCTACTGGTATTGTACGTAAAGTTGATGAATTAGGACGTGTAGTGATTCCTATCGAACTGCGTCGTAC
TCTTGGAATCGCAGAAAAAGATGCTCTTGAAATTTATGTTGATGATGAAAAAATCATCCTTAAAAAATATAAACCAAACA
TGACTTGCCAAGTAACTGGTGAAGTTTCTGACGATAACCTTAAACTTGCTGGCGGCAAATTGGTACTAAGCAAAGAAGGC
GCTGAGCAAATCATCAGCGAAATCCAAAACCAGCTTCAAAACCTTAAATAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |