Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | BTB_RS09560 | Genome accession | NC_018877 |
| Coordinates | 1869582..1869863 (+) | Length | 93 a.a. |
| NCBI ID | WP_000843025.1 | Uniprot ID | A0AAN4KMT0 |
| Organism | Bacillus thuringiensis Bt407 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1862922..1925100 | 1869582..1869863 | within | 0 |
Gene organization within MGE regions
Location: 1862922..1925100
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BTB_RS09510 (BTB_c19320) | - | 1863244..1863552 (+) | 309 | WP_000391475.1 | hypothetical protein | - |
| BTB_RS32285 (BTB_c19330) | - | 1863590..1864570 (+) | 981 | WP_000422433.1 | site-specific DNA-methyltransferase | - |
| BTB_RS09525 (BTB_c19340) | - | 1864812..1865309 (+) | 498 | WP_000404006.1 | hypothetical protein | - |
| BTB_RS34820 (BTB_c19350) | - | 1865361..1865528 (+) | 168 | WP_000539655.1 | hypothetical protein | - |
| BTB_RS09530 (BTB_c19360) | - | 1866656..1867066 (+) | 411 | WP_000053745.1 | hypothetical protein | - |
| BTB_RS09535 (BTB_c19370) | - | 1867063..1867716 (+) | 654 | WP_001043868.1 | hypothetical protein | - |
| BTB_RS09540 (BTB_c19380) | - | 1867838..1868155 (+) | 318 | WP_000805617.1 | hypothetical protein | - |
| BTB_RS09545 (BTB_c19390) | - | 1868172..1869089 (+) | 918 | WP_000154978.1 | hypothetical protein | - |
| BTB_RS09550 (BTB_c19400) | - | 1869092..1869238 (+) | 147 | WP_000790088.1 | BC1881 family protein | - |
| BTB_RS09555 (BTB_c19410) | - | 1869364..1869585 (+) | 222 | WP_001202995.1 | hypothetical protein | - |
| BTB_RS09560 (BTB_c19420) | abrB | 1869582..1869863 (+) | 282 | WP_000843025.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| BTB_RS09565 (BTB_c19430) | - | 1869865..1870062 (+) | 198 | WP_001294615.1 | hypothetical protein | - |
| BTB_RS09570 (BTB_c19440) | - | 1870089..1870256 (+) | 168 | WP_080546110.1 | hypothetical protein | - |
| BTB_RS09575 (BTB_c19450) | - | 1870259..1870783 (+) | 525 | WP_000410292.1 | hypothetical protein | - |
| BTB_RS09580 (BTB_c19460) | - | 1870780..1870962 (+) | 183 | WP_001106358.1 | DUF6877 family protein | - |
| BTB_RS09585 (BTB_c19470) | - | 1870952..1871278 (+) | 327 | WP_000200015.1 | hypothetical protein | - |
| BTB_RS09590 (BTB_c19480) | - | 1871539..1871919 (+) | 381 | WP_000196741.1 | hypothetical protein | - |
| BTB_RS09595 (BTB_c19490) | - | 1872326..1872889 (+) | 564 | WP_000873650.1 | recombinase family protein | - |
| BTB_RS09600 (BTB_c19500) | - | 1873087..1873515 (+) | 429 | WP_001086032.1 | phBC6A51 family helix-turn-helix protein | - |
| BTB_RS09605 (BTB_c19510) | terL | 1873532..1875247 (+) | 1716 | WP_000323341.1 | phage terminase large subunit | - |
| BTB_RS09610 (BTB_c19520) | - | 1875264..1876781 (+) | 1518 | WP_001265883.1 | phage portal protein | - |
| BTB_RS09615 (BTB_c19530) | - | 1876855..1877619 (+) | 765 | WP_000455455.1 | phage scaffolding protein | - |
| BTB_RS09620 (BTB_c19540) | - | 1877680..1878804 (+) | 1125 | WP_001145075.1 | DUF5309 family protein | - |
| BTB_RS09625 (BTB_c19550) | - | 1878854..1879078 (+) | 225 | WP_000027969.1 | head fiber protein | - |
| BTB_RS09630 (BTB_c19560) | - | 1879108..1879449 (+) | 342 | WP_000868477.1 | hypothetical protein | - |
| BTB_RS09635 (BTB_c19570) | - | 1879454..1880260 (+) | 807 | WP_001285263.1 | hypothetical protein | - |
| BTB_RS09640 (BTB_c19580) | - | 1880264..1880638 (+) | 375 | WP_000954643.1 | hypothetical protein | - |
| BTB_RS09645 (BTB_c19590) | - | 1880638..1880997 (+) | 360 | WP_001222696.1 | hypothetical protein | - |
| BTB_RS09650 (BTB_c19600) | - | 1881000..1881407 (+) | 408 | WP_000930921.1 | hypothetical protein | - |
| BTB_RS09655 (BTB_c19610) | - | 1881421..1881927 (+) | 507 | WP_000852562.1 | phage major tail protein, TP901-1 family | - |
| BTB_RS09660 (BTB_c19620) | - | 1881951..1882310 (+) | 360 | WP_000443956.1 | hypothetical protein | - |
| BTB_RS09665 (BTB_c19630) | - | 1882297..1882512 (+) | 216 | WP_000762691.1 | hypothetical protein | - |
| BTB_RS09670 (BTB_c19640) | - | 1882580..1882957 (+) | 378 | WP_000818630.1 | tail assembly chaperone | - |
| BTB_RS09675 (BTB_c19650) | - | 1883047..1883301 (+) | 255 | WP_000931847.1 | hypothetical protein | - |
| BTB_RS09680 (BTB_c19660) | - | 1883338..1887234 (+) | 3897 | WP_003271441.1 | phage tail tape measure protein | - |
| BTB_RS09685 (BTB_c19670) | - | 1887249..1888745 (+) | 1497 | WP_000959919.1 | distal tail protein Dit | - |
| BTB_RS09690 (BTB_c19680) | - | 1888742..1893721 (+) | 4980 | WP_001260209.1 | phage tail spike protein | - |
| BTB_RS09695 (BTB_c19690) | - | 1893733..1894113 (+) | 381 | WP_000342975.1 | hypothetical protein | - |
| BTB_RS09700 (BTB_c19700) | - | 1894213..1895172 (+) | 960 | WP_000822841.1 | site-specific integrase | - |
| BTB_RS09705 (BTB_c19710) | - | 1895188..1895613 (+) | 426 | WP_000373895.1 | holin family protein | - |
| BTB_RS09710 (BTB_c19720) | - | 1895613..1896446 (+) | 834 | WP_001216050.1 | GH25 family lysozyme | - |
| BTB_RS09715 (BTB_c19730) | - | 1896501..1896767 (-) | 267 | WP_000370580.1 | hypothetical protein | - |
| BTB_RS34825 (BTB_c19740) | - | 1896877..1897020 (-) | 144 | WP_000727572.1 | hypothetical protein | - |
| BTB_RS09720 (BTB_c19750) | - | 1897047..1897649 (-) | 603 | WP_001230989.1 | hypothetical protein | - |
| BTB_RS09725 (BTB_c19760) | - | 1897749..1897985 (-) | 237 | WP_000578036.1 | helix-turn-helix transcriptional regulator | - |
| BTB_RS34435 (BTB_c19770) | - | 1898142..1898264 (+) | 123 | WP_000854597.1 | DUF3961 domain-containing protein | - |
| BTB_RS09730 (BTB_c19780) | - | 1898906..1899106 (-) | 201 | WP_000669093.1 | helix-turn-helix transcriptional regulator | - |
| BTB_RS09735 (BTB_c19790) | - | 1899292..1899558 (+) | 267 | WP_001247349.1 | hypothetical protein | - |
| BTB_RS09740 (BTB_c19800) | - | 1899558..1899860 (+) | 303 | WP_001267622.1 | hypothetical protein | - |
| BTB_RS09745 (BTB_c19810) | - | 1899857..1900039 (+) | 183 | WP_000176361.1 | hypothetical protein | - |
| BTB_RS09750 (BTB_c19820) | - | 1900155..1901339 (+) | 1185 | WP_000891521.1 | FtsK/SpoIIIE domain-containing protein | - |
| BTB_RS09755 (BTB_c19830) | - | 1901281..1901904 (+) | 624 | WP_001025807.1 | replication-relaxation family protein | - |
| BTB_RS09765 (BTB_c19850) | - | 1902145..1902333 (+) | 189 | WP_000771630.1 | hypothetical protein | - |
| BTB_RS09770 (BTB_c19860) | - | 1902353..1902568 (+) | 216 | WP_000200736.1 | hypothetical protein | - |
| BTB_RS09775 (BTB_c19870) | - | 1902888..1903523 (+) | 636 | Protein_1889 | recombinase family protein | - |
| BTB_RS09780 (BTB_c19880) | - | 1903637..1905073 (-) | 1437 | WP_001053955.1 | IS4-like element IS231A family transposase | - |
| BTB_RS09785 (BTB_c19890) | - | 1905173..1906018 (+) | 846 | Protein_1891 | recombinase family protein | - |
| BTB_RS09790 (BTB_c19900) | - | 1906047..1907047 (+) | 1001 | Protein_1892 | amidase family protein | - |
| BTB_RS09795 (BTB_c19910) | - | 1907230..1908243 (+) | 1014 | WP_001006602.1 | AI-2E family transporter | - |
| BTB_RS09800 (BTB_c19920) | - | 1908331..1909275 (-) | 945 | WP_000715322.1 | L-lactate dehydrogenase | - |
| BTB_RS09805 (BTB_c19930) | - | 1909476..1910912 (+) | 1437 | WP_000528004.1 | flavin monoamine oxidase family protein | - |
| BTB_RS09810 (BTB_c19940) | - | 1911019..1911942 (+) | 924 | WP_001044937.1 | GTP-binding protein | - |
| BTB_RS09815 (BTB_c19950) | - | 1912205..1913422 (+) | 1218 | WP_000062000.1 | substrate-binding domain-containing protein | - |
| BTB_RS09820 (BTB_c19960) | - | 1913511..1914284 (+) | 774 | WP_000149328.1 | ABC transporter ATP-binding protein | - |
| BTB_RS09825 (BTB_c19970) | - | 1914262..1914963 (+) | 702 | WP_001196696.1 | ABC transporter ATP-binding protein | - |
| BTB_RS09830 (BTB_c19980) | - | 1914985..1915845 (+) | 861 | WP_000382787.1 | branched-chain amino acid ABC transporter permease | - |
| BTB_RS09835 (BTB_c19990) | - | 1915895..1916848 (+) | 954 | WP_003274156.1 | branched-chain amino acid ABC transporter permease | - |
| BTB_RS09840 (BTB_c20000) | - | 1916942..1917730 (-) | 789 | WP_000404995.1 | LysR family transcriptional regulator | - |
| BTB_RS09845 (BTB_c20010) | - | 1917851..1918399 (+) | 549 | WP_000579908.1 | DUF4865 family protein | - |
| BTB_RS09850 (BTB_c20020) | - | 1918442..1918861 (+) | 420 | WP_001117237.1 | tautomerase family protein | - |
| BTB_RS09855 (BTB_c20030) | - | 1918851..1919174 (+) | 324 | WP_000787201.1 | carboxymuconolactone decarboxylase family protein | - |
| BTB_RS09860 (BTB_c20040) | - | 1919328..1919771 (+) | 444 | WP_001205523.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| BTB_RS09865 (BTB_c20050) | - | 1919891..1920946 (+) | 1056 | WP_000417549.1 | LLM class flavin-dependent oxidoreductase | - |
| BTB_RS09870 (BTB_c20060) | cydA | 1921539..1922942 (+) | 1404 | WP_000448869.1 | cytochrome ubiquinol oxidase subunit I | - |
| BTB_RS09875 (BTB_c20070) | cydB | 1922929..1923945 (+) | 1017 | WP_000950083.1 | cytochrome d ubiquinol oxidase subunit II | - |
Sequence
Protein
Download Length: 93 a.a. Molecular weight: 10244.87 Da Isoelectric Point: 4.6282
>NTDB_id=54135 BTB_RS09560 WP_000843025.1 1869582..1869863(+) (abrB) [Bacillus thuringiensis Bt407]
MKSTGIIRNIDPLGRIVVPMELRRTLGIQVKDPMEIFVDGESIILQKYNPNNSCQITGEVSEENIELAGGKLVLSPEGVD
QVLAELEARLKGR
MKSTGIIRNIDPLGRIVVPMELRRTLGIQVKDPMEIFVDGESIILQKYNPNNSCQITGEVSEENIELAGGKLVLSPEGVD
QVLAELEARLKGR
Nucleotide
Download Length: 282 bp
>NTDB_id=54135 BTB_RS09560 WP_000843025.1 1869582..1869863(+) (abrB) [Bacillus thuringiensis Bt407]
ATGAAATCAACAGGTATCATTCGTAACATTGATCCATTAGGACGTATTGTGGTTCCAATGGAATTACGCCGTACATTAGG
TATCCAGGTAAAGGATCCGATGGAGATTTTCGTAGATGGTGAATCTATTATTCTACAAAAATATAACCCTAATAACTCTT
GCCAAATTACAGGAGAGGTTTCAGAAGAAAATATTGAACTAGCTGGCGGTAAACTCGTGCTAAGTCCTGAAGGGGTTGAT
CAGGTATTAGCGGAACTCGAAGCACGTTTGAAGGGGCGATAA
ATGAAATCAACAGGTATCATTCGTAACATTGATCCATTAGGACGTATTGTGGTTCCAATGGAATTACGCCGTACATTAGG
TATCCAGGTAAAGGATCCGATGGAGATTTTCGTAGATGGTGAATCTATTATTCTACAAAAATATAACCCTAATAACTCTT
GCCAAATTACAGGAGAGGTTTCAGAAGAAAATATTGAACTAGCTGGCGGTAAACTCGTGCTAAGTCCTGAAGGGGTTGAT
CAGGTATTAGCGGAACTCGAAGCACGTTTGAAGGGGCGATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
62.637 |
97.849 |
0.613 |