NTDB

Overview

Name	comGC	Type	Machinery gene
Locus tag	JWR96_RS00160	Genome accession	NZ_CP070856
Coordinates	40460..40759 (+)	Length	99 a.a.
NCBI ID	WP_052206590.1	Uniprot ID	A0AAX4ALD2
Organism	Lactococcus cremoris strain GR0507
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 35460..45759

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
JWR96_RS00150 (JWR96_00150)	comGA	38511..39491 (+)	981	WP_043736167.1	competence type IV pilus ATPase ComGA	Machinery gene
JWR96_RS00155 (JWR96_00155)	comGB	39391..40416 (+)	1026	WP_052206589.1	competence type IV pilus assembly protein ComGB	Machinery gene
JWR96_RS00160 (JWR96_00160)	comGC	40460..40759 (+)	300	WP_052206590.1	competence type IV pilus major pilin ComGC	Machinery gene
JWR96_RS00165 (JWR96_00165)	comGD	40770..41201 (+)	432	WP_050750513.1	competence type IV pilus minor pilin ComGD	Machinery gene
JWR96_RS00170 (JWR96_00170)	comGE	41173..41469 (+)	297	WP_043736169.1	competence type IV pilus minor pilin ComGE	Machinery gene
JWR96_RS00175 (JWR96_00175)	comGF	41432..41878 (+)	447	WP_043736171.1	competence type IV pilus minor pilin ComGF	Machinery gene
JWR96_RS00180 (JWR96_00180)	comGG	41902..42201 (+)	300	WP_021037947.1	competence type IV pilus minor pilin ComGG	Machinery gene
JWR96_RS00185 (JWR96_00185)	-	42282..42719 (+)	438	WP_011677180.1	zinc-dependent MarR family transcriptional regulator	-
JWR96_RS00190 (JWR96_00190)	-	42716..43558 (+)	843	WP_011677179.1	zinc ABC transporter substrate-binding protein	-
JWR96_RS00195 (JWR96_00195)	-	43760..45132 (+)	1373	WP_185753013.1	IS3 family transposase	-

Sequence

Protein

Download Length: 99 a.a. Molecular weight: 11065.24 Da Isoelectric Point: 10.2061

                                >NTDB_id=541045 JWR96_RS00160 WP_052206590.1 40460..40759(+) (comGC) [Lactococcus cremoris strain GR0507]

MSKALSLIKIHGRKLWQKKQKAFTLIEMLIVLAIISILILLFVPNLIKEKAQVQKTGEAAVVKVVESQAQLYELDHDNDK

PNLSELLSAGMITQKQVTA

Nucleotide

Download Length: 300 bp

                                >NTDB_id=541045 JWR96_RS00160 WP_052206590.1 40460..40759(+) (comGC) [Lactococcus cremoris strain GR0507]

ATGAGCAAAGCTTTGTCATTAATTAAAATTCACGGAAGAAAACTTTGGCAAAAAAAGCAAAAAGCATTTACCTTGATTGA

GATGTTAATTGTGTTGGCAATTATCAGTATTTTAATTTTGCTTTTTGTGCCAAATTTGATAAAAGAAAAAGCACAAGTTC

AAAAAACTGGTGAAGCAGCAGTAGTTAAAGTAGTTGAAAGTCAGGCACAACTTTATGAGTTGGATCATGATAATGATAAG

CCAAACCTATCAGAACTTTTAAGTGCGGGGATGATTACGCAAAAGCAAGTCACGGCCTAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(18-41)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGC	Lactococcus lactis subsp. cremoris KW2	97.98	100	0.98
comYC	Streptococcus gordonii str. Challis substr. CH1	63.095	84.848	0.535
comGC/cglC	Streptococcus mitis SK321	60	85.859	0.515
comGC/cglC	Streptococcus mitis NCTC 12261	60	85.859	0.515
comYC	Streptococcus mutans UA140	63.291	79.798	0.505
comYC	Streptococcus mutans UA159	63.291	79.798	0.505
comGC/cglC	Streptococcus pneumoniae R6	57.647	85.859	0.495
comGC/cglC	Streptococcus pneumoniae TIGR4	57.647	85.859	0.495
comGC/cglC	Streptococcus pneumoniae Rx1	57.647	85.859	0.495
comGC/cglC	Streptococcus pneumoniae D39	57.647	85.859	0.495
comYC	Streptococcus suis isolate S10	58.333	84.848	0.495
comGC	Staphylococcus aureus MW2	46.341	82.828	0.384
comGC	Staphylococcus aureus N315	46.341	82.828	0.384

Detailed information NTG0541045