Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   JOW61_RS16280 Genome accession   NZ_CP070844
Coordinates   3032146..3032286 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. natto strain BN0     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3027146..3037286
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JOW61_RS16255 (JOW61_16110) yuxO 3027423..3027803 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  JOW61_RS16260 (JOW61_16115) comA 3027822..3028466 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  JOW61_RS16265 (JOW61_16120) comP 3028547..3030859 (-) 2313 WP_014480703.1 sensor histidine kinase Regulator
  JOW61_RS16270 (JOW61_16125) comX 3030875..3031096 (-) 222 WP_014480704.1 competence pheromone ComX -
  JOW61_RS16275 (JOW61_16130) - 3031098..3031961 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  JOW61_RS16280 (JOW61_16135) degQ 3032146..3032286 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  JOW61_RS16285 (JOW61_16140) - 3032508..3032633 (+) 126 WP_003228793.1 hypothetical protein -
  JOW61_RS16290 (JOW61_16145) - 3032747..3033115 (+) 369 WP_014477834.1 hypothetical protein -
  JOW61_RS16295 (JOW61_16150) pdeH 3033091..3034320 (-) 1230 WP_014480707.1 cyclic di-GMP phosphodiesterase -
  JOW61_RS16300 (JOW61_16155) pncB 3034456..3035928 (-) 1473 WP_014480708.1 nicotinate phosphoribosyltransferase -
  JOW61_RS16305 (JOW61_16160) pncA 3035944..3036495 (-) 552 WP_014480709.1 isochorismatase family cysteine hydrolase -
  JOW61_RS16310 (JOW61_16165) yueI 3036592..3036990 (-) 399 WP_014480710.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=541024 JOW61_RS16280 WP_003220708.1 3032146..3032286(-) (degQ) [Bacillus subtilis subsp. natto strain BN0]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=541024 JOW61_RS16280 WP_003220708.1 3032146..3032286(-) (degQ) [Bacillus subtilis subsp. natto strain BN0]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1