Detailed information
Overview
| Name | nucA/comI | Type | Machinery gene |
| Locus tag | JWY35_RS13315 | Genome accession | NZ_CP070485 |
| Coordinates | 2468654..2469064 (-) | Length | 136 a.a. |
| NCBI ID | WP_009967785.1 | Uniprot ID | A0A6I4D881 |
| Organism | Bacillus subtilis strain JNFE1126 | ||
| Function | cleavage of dsDNA into ssDNA (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2462862..2498809 | 2468654..2469064 | within | 0 |
Gene organization within MGE regions
Location: 2462862..2498809
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JWY35_RS13280 (JWY35_13170) | yqeG | 2462862..2463380 (-) | 519 | WP_003226126.1 | YqeG family HAD IIIA-type phosphatase | - |
| JWY35_RS13285 (JWY35_13175) | - | 2463742..2463882 (+) | 141 | WP_003226124.1 | sporulation histidine kinase inhibitor Sda | - |
| JWY35_RS13290 (JWY35_13180) | yqeF | 2464188..2464919 (-) | 732 | WP_003229964.1 | SGNH/GDSL hydrolase family protein | - |
| JWY35_RS13295 (JWY35_13185) | cwlH | 2465171..2465923 (-) | 753 | WP_014480318.1 | N-acetylmuramoyl-L-alanine amidase CwlH | - |
| JWY35_RS13300 (JWY35_13190) | yqeD | 2466110..2466736 (+) | 627 | WP_014480319.1 | TVP38/TMEM64 family protein | - |
| JWY35_RS13305 (JWY35_13195) | gnd | 2466755..2467648 (-) | 894 | WP_014480320.1 | phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) | - |
| JWY35_RS13310 (JWY35_13200) | yqeB | 2467899..2468621 (+) | 723 | WP_014480321.1 | hypothetical protein | - |
| JWY35_RS13315 (JWY35_13205) | nucA/comI | 2468654..2469064 (-) | 411 | WP_009967785.1 | sporulation-specific Dnase NucB | Machinery gene |
| JWY35_RS13320 (JWY35_13210) | sigK | 2469260..2469988 (+) | 729 | WP_013308023.1 | RNA polymerase sporulation sigma factor SigK | - |
| JWY35_RS13325 (JWY35_13215) | - | 2469988..2470086 (+) | 99 | WP_031600702.1 | hypothetical protein | - |
| JWY35_RS13330 | - | 2470083..2470295 (-) | 213 | Protein_2580 | recombinase family protein | - |
| JWY35_RS13335 (JWY35_13225) | fumC | 2470514..2471902 (-) | 1389 | WP_014480325.1 | class II fumarate hydratase | - |
| JWY35_RS13340 (JWY35_13230) | - | 2472069..2472959 (+) | 891 | WP_014480326.1 | LysR family transcriptional regulator | - |
| JWY35_RS13345 (JWY35_13235) | - | 2473901..2474296 (+) | 396 | WP_014480327.1 | VOC family protein | - |
| JWY35_RS13355 (JWY35_13240) | - | 2475036..2476163 (-) | 1128 | WP_014480328.1 | Rap family tetratricopeptide repeat protein | - |
| JWY35_RS22620 | - | 2476345..2477178 (+) | 834 | Protein_2585 | ribonuclease YeeF family protein | - |
| JWY35_RS22625 | - | 2477564..2478271 (+) | 708 | WP_014480330.1 | hypothetical protein | - |
| JWY35_RS13370 (JWY35_13250) | - | 2478285..2478572 (+) | 288 | WP_014480331.1 | hypothetical protein | - |
| JWY35_RS13375 (JWY35_13255) | - | 2478975..2479415 (+) | 441 | WP_014480332.1 | SMI1/KNR4 family protein | - |
| JWY35_RS13380 (JWY35_13260) | - | 2479514..2479966 (+) | 453 | WP_014480333.1 | SMI1/KNR4 family protein | - |
| JWY35_RS13385 (JWY35_13265) | cdiI | 2480063..2480422 (+) | 360 | WP_014480334.1 | ribonuclease toxin immunity protein CdiI | - |
| JWY35_RS13390 (JWY35_13270) | - | 2480527..2481006 (+) | 480 | WP_224588637.1 | hypothetical protein | - |
| JWY35_RS13395 (JWY35_13275) | - | 2481314..2481517 (-) | 204 | WP_123772462.1 | hypothetical protein | - |
| JWY35_RS13400 (JWY35_13280) | - | 2481606..2481839 (+) | 234 | WP_224588641.1 | hypothetical protein | - |
| JWY35_RS13405 (JWY35_13285) | atxG | 2482107..2482684 (+) | 578 | Protein_2594 | suppressor of fused domain protein | - |
| JWY35_RS13410 (JWY35_13290) | - | 2482794..2483084 (+) | 291 | WP_014480337.1 | contact-dependent growth inhibition system immunity protein | - |
| JWY35_RS13415 (JWY35_13295) | istA | 2483925..2485472 (+) | 1548 | WP_014480339.1 | IS21 family transposase | - |
| JWY35_RS13420 (JWY35_13300) | istB | 2485469..2486227 (+) | 759 | WP_014479891.1 | IS21-like element helper ATPase IstB | - |
| JWY35_RS22630 (JWY35_13305) | - | 2486479..2486645 (-) | 167 | Protein_2598 | peptidoglycan-binding domain-containing protein | - |
| JWY35_RS13430 (JWY35_13310) | - | 2486820..2486906 (+) | 87 | WP_072592549.1 | putative holin-like toxin | - |
| JWY35_RS22635 (JWY35_13315) | - | 2487193..2487668 (-) | 476 | Protein_2600 | phage tail tube protein | - |
| JWY35_RS13445 (JWY35_13320) | terS | 2487628..2488192 (-) | 565 | Protein_2601 | phage terminase small subunit | - |
| JWY35_RS13450 (JWY35_13325) | - | 2488319..2488624 (+) | 306 | WP_123772463.1 | hypothetical protein | - |
| JWY35_RS13460 (JWY35_13330) | - | 2489017..2489496 (-) | 480 | WP_014480344.1 | hypothetical protein | - |
| JWY35_RS13465 (JWY35_13335) | - | 2490113..2490379 (+) | 267 | WP_033881358.1 | hypothetical protein | - |
| JWY35_RS13470 (JWY35_13340) | - | 2490518..2490670 (-) | 153 | WP_049832653.1 | XtrA/YqaO family protein | - |
| JWY35_RS13475 (JWY35_13345) | - | 2490753..2490875 (-) | 123 | Protein_2606 | RusA family crossover junction endodeoxyribonuclease | - |
| JWY35_RS13480 (JWY35_13350) | - | 2490838..2491086 (-) | 249 | Protein_2607 | hypothetical protein | - |
| JWY35_RS13485 | - | 2491231..2491461 (-) | 231 | WP_224588644.1 | hypothetical protein | - |
| JWY35_RS13490 (JWY35_13360) | - | 2491770..2491950 (-) | 181 | Protein_2609 | hypothetical protein | - |
| JWY35_RS13495 (JWY35_13365) | bltR | 2492158..2492979 (-) | 822 | WP_014480349.1 | multidrug efflux transcriptional regulator BltR | - |
| JWY35_RS13500 (JWY35_13370) | blt | 2493096..2494298 (+) | 1203 | WP_014480350.1 | multidrug efflux MFS transporter Blt | - |
| JWY35_RS13505 (JWY35_13375) | bltD | 2494480..2494938 (+) | 459 | WP_014480351.1 | spermine/spermidine acetyltransferase | - |
| JWY35_RS13510 (JWY35_13380) | yrkA | 2495097..2496401 (-) | 1305 | WP_014480352.1 | hemolysin family protein | - |
| JWY35_RS13515 (JWY35_13385) | yrzO | 2496691..2496834 (-) | 144 | WP_014477437.1 | YrzO family protein | - |
| JWY35_RS13520 (JWY35_13390) | yrdR | 2496852..2497817 (-) | 966 | WP_014480354.1 | DMT family transporter | - |
| JWY35_RS13525 (JWY35_13395) | czcR | 2497943..2498809 (+) | 867 | WP_014480355.1 | LysR family transcriptional regulator CzcR | - |
Sequence
Protein
Download Length: 136 a.a. Molecular weight: 14967.97 Da Isoelectric Point: 5.1853
>NTDB_id=540105 JWY35_RS13315 WP_009967785.1 2468654..2469064(-) (nucA/comI) [Bacillus subtilis strain JNFE1126]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
Nucleotide
Download Length: 411 bp
>NTDB_id=540105 JWY35_RS13315 WP_009967785.1 2468654..2469064(-) (nucA/comI) [Bacillus subtilis strain JNFE1126]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAG
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| nucA/comI | Bacillus subtilis subsp. subtilis str. 168 |
62.609 |
84.559 |
0.529 |