Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   LK447_RS03120 Genome accession   NZ_CP085947
Coordinates   639061..639174 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   Q9ZEL1
Organism   Helicobacter pylori strain FDAARGOS_1563     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 634061..644174
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LK447_RS03095 (LK447_03095) - 634114..636339 (+) 2226 WP_001051489.1 ATP-dependent Clp protease ATP-binding subunit -
  LK447_RS03100 (LK447_03100) panD 636329..636682 (+) 354 WP_000142221.1 aspartate 1-decarboxylase -
  LK447_RS03105 (LK447_03105) - 636685..636987 (+) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  LK447_RS03110 (LK447_03110) - 636987..637982 (+) 996 WP_000468489.1 PDZ domain-containing protein -
  LK447_RS03115 (LK447_03115) comB6 637990..639045 (+) 1056 WP_000786680.1 type IV secretion system protein Machinery gene
  LK447_RS03120 (LK447_03120) comB7 639061..639174 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  LK447_RS03125 (LK447_03125) comB8 639171..639914 (+) 744 WP_000660512.1 virB8 family protein Machinery gene
  LK447_RS03130 (LK447_03130) comB9 639914..640897 (+) 984 WP_012552342.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  LK447_RS03135 (LK447_03135) comB10 640890..642026 (+) 1137 WP_001045858.1 DNA type IV secretion system protein ComB10 Machinery gene
  LK447_RS03140 (LK447_03140) - 642098..643516 (+) 1419 WP_000694877.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=539286 LK447_RS03120 WP_001217873.1 639061..639174(+) (comB7) [Helicobacter pylori strain FDAARGOS_1563]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=539286 LK447_RS03120 WP_001217873.1 639061..639174(+) (comB7) [Helicobacter pylori strain FDAARGOS_1563]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q9ZEL1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1