Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | JTF64_RS27465 | Genome accession | NZ_CP070339 |
| Coordinates | 5375990..5376268 (+) | Length | 92 a.a. |
| NCBI ID | WP_205190455.1 | Uniprot ID | - |
| Organism | Bacillus cereus strain VKM B-370 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 5365076..5387594 | 5375990..5376268 | within | 0 |
Gene organization within MGE regions
Location: 5365076..5387594
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JTF64_RS27375 (JTF64_27330) | - | 5365076..5365867 (+) | 792 | WP_000662584.1 | patatin-like phospholipase family protein | - |
| JTF64_RS27380 (JTF64_27335) | - | 5365860..5366897 (+) | 1038 | WP_000476296.1 | SepM family pheromone-processing serine protease | - |
| JTF64_RS27385 (JTF64_27340) | - | 5366908..5368089 (-) | 1182 | WP_003307657.1 | nucleotidyltransferase | - |
| JTF64_RS27390 (JTF64_27345) | - | 5368284..5369414 (-) | 1131 | WP_205190446.1 | site-specific integrase | - |
| JTF64_RS27395 (JTF64_27350) | - | 5369576..5369725 (+) | 150 | WP_033694515.1 | hypothetical protein | - |
| JTF64_RS27400 (JTF64_27355) | - | 5369747..5369935 (+) | 189 | WP_205190447.1 | hypothetical protein | - |
| JTF64_RS27405 (JTF64_27360) | - | 5369938..5370096 (+) | 159 | WP_098294273.1 | hypothetical protein | - |
| JTF64_RS27410 (JTF64_27365) | - | 5370093..5370254 (+) | 162 | WP_205190448.1 | hypothetical protein | - |
| JTF64_RS27415 (JTF64_27370) | - | 5370345..5370689 (-) | 345 | WP_205190449.1 | helix-turn-helix transcriptional regulator | - |
| JTF64_RS27420 (JTF64_27375) | - | 5371126..5372223 (+) | 1098 | WP_205190450.1 | AimR family lysis-lysogeny pheromone receptor | - |
| JTF64_RS27425 (JTF64_27380) | - | 5372236..5372385 (+) | 150 | WP_000719898.1 | hypothetical protein | - |
| JTF64_RS29905 | - | 5372505..5372633 (+) | 129 | WP_263979512.1 | hypothetical protein | - |
| JTF64_RS27430 (JTF64_27385) | - | 5372649..5373017 (-) | 369 | WP_205190451.1 | helix-turn-helix transcriptional regulator | - |
| JTF64_RS27435 (JTF64_27390) | - | 5373236..5373463 (+) | 228 | WP_000516834.1 | helix-turn-helix transcriptional regulator | - |
| JTF64_RS27440 (JTF64_27395) | - | 5373515..5373715 (+) | 201 | WP_000284332.1 | helix-turn-helix domain-containing protein | - |
| JTF64_RS27445 (JTF64_27400) | - | 5373772..5373936 (+) | 165 | WP_000390306.1 | hypothetical protein | - |
| JTF64_RS27450 (JTF64_27405) | - | 5373994..5375061 (+) | 1068 | WP_205190452.1 | DnaD domain protein | - |
| JTF64_RS27455 (JTF64_27410) | - | 5375065..5375547 (+) | 483 | WP_205190453.1 | YpiB family protein | - |
| JTF64_RS27460 (JTF64_27415) | - | 5375562..5375972 (+) | 411 | WP_205190454.1 | hypothetical protein | - |
| JTF64_RS27465 (JTF64_27420) | abrB | 5375990..5376268 (+) | 279 | WP_205190455.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| JTF64_RS27470 (JTF64_27425) | - | 5376261..5376620 (+) | 360 | WP_033698079.1 | hypothetical protein | - |
| JTF64_RS27475 (JTF64_27430) | - | 5376640..5376804 (+) | 165 | WP_002066822.1 | DUF3954 domain-containing protein | - |
| JTF64_RS27480 (JTF64_27435) | - | 5376830..5377303 (+) | 474 | WP_061685159.1 | hypothetical protein | - |
| JTF64_RS27485 (JTF64_27440) | - | 5377324..5377839 (+) | 516 | WP_205190456.1 | dUTP diphosphatase | - |
| JTF64_RS27490 (JTF64_27445) | - | 5377843..5378319 (+) | 477 | WP_205190457.1 | hypothetical protein | - |
| JTF64_RS27495 (JTF64_27450) | - | 5378533..5378943 (-) | 411 | WP_205190458.1 | S-Ena type endospore appendage | - |
| JTF64_RS27500 (JTF64_27455) | - | 5379036..5379368 (-) | 333 | WP_098368221.1 | S-Ena type endospore appendage | - |
| JTF64_RS27505 | - | 5379835..5380143 (+) | 309 | Protein_5379 | hypothetical protein | - |
| JTF64_RS27510 (JTF64_27460) | - | 5382021..5382365 (+) | 345 | WP_225913349.1 | hypothetical protein | - |
| JTF64_RS27515 (JTF64_27465) | - | 5382475..5382597 (+) | 123 | WP_205190459.1 | DUF3983 domain-containing protein | - |
| JTF64_RS27520 (JTF64_27470) | - | 5382713..5382883 (+) | 171 | WP_205190460.1 | hypothetical protein | - |
| JTF64_RS27525 (JTF64_27475) | - | 5382911..5383393 (+) | 483 | WP_000166190.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| JTF64_RS27530 (JTF64_27480) | - | 5383393..5383935 (+) | 543 | WP_075716700.1 | site-specific integrase | - |
| JTF64_RS27535 (JTF64_27485) | - | 5384528..5385274 (+) | 747 | WP_205190461.1 | site-specific DNA-methyltransferase | - |
| JTF64_RS27540 (JTF64_27490) | - | 5385307..5385636 (+) | 330 | WP_205190462.1 | hypothetical protein | - |
| JTF64_RS27545 (JTF64_27495) | - | 5385623..5385835 (+) | 213 | WP_205190463.1 | hypothetical protein | - |
| JTF64_RS30020 | - | 5386148..5386333 (+) | 186 | WP_318784857.1 | hypothetical protein | - |
| JTF64_RS29750 | - | 5386340..5386594 (+) | 255 | WP_225913351.1 | hypothetical protein | - |
| JTF64_RS27555 (JTF64_27505) | - | 5386584..5386961 (+) | 378 | WP_016109623.1 | HNH endonuclease | - |
| JTF64_RS27560 (JTF64_27510) | - | 5387091..5387594 (+) | 504 | WP_205190464.1 | phage terminase small subunit P27 family | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 9982.58 Da Isoelectric Point: 5.1544
>NTDB_id=539245 JTF64_RS27465 WP_205190455.1 5375990..5376268(+) (abrB) [Bacillus cereus strain VKM B-370]
MKNTGVTRKVDELGRVVIPIELRRTLGIAEGTALDFHVDGENIILRKPEKSCFVTGEVSESNIELLGGRMVLSKEGASEL
LDLLQKCGMANA
MKNTGVTRKVDELGRVVIPIELRRTLGIAEGTALDFHVDGENIILRKPEKSCFVTGEVSESNIELLGGRMVLSKEGASEL
LDLLQKCGMANA
Nucleotide
Download Length: 279 bp
>NTDB_id=539245 JTF64_RS27465 WP_205190455.1 5375990..5376268(+) (abrB) [Bacillus cereus strain VKM B-370]
ATGAAAAATACAGGTGTTACAAGAAAAGTGGACGAGCTAGGTCGCGTAGTAATTCCAATTGAGTTACGCAGAACTTTGGG
TATTGCTGAAGGGACAGCATTAGACTTTCATGTTGACGGAGAAAACATCATTTTAAGAAAACCAGAAAAGTCATGTTTTG
TAACAGGTGAAGTGTCTGAATCCAACATCGAATTGTTAGGCGGCCGAATGGTTTTGAGTAAGGAAGGGGCAAGTGAGTTA
TTGGACCTTCTTCAAAAGTGTGGGATGGCAAATGCCTAA
ATGAAAAATACAGGTGTTACAAGAAAAGTGGACGAGCTAGGTCGCGTAGTAATTCCAATTGAGTTACGCAGAACTTTGGG
TATTGCTGAAGGGACAGCATTAGACTTTCATGTTGACGGAGAAAACATCATTTTAAGAAAACCAGAAAAGTCATGTTTTG
TAACAGGTGAAGTGTCTGAATCCAACATCGAATTGTTAGGCGGCCGAATGGTTTTGAGTAAGGAAGGGGCAAGTGAGTTA
TTGGACCTTCTTCAAAAGTGTGGGATGGCAAATGCCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
64.368 |
94.565 |
0.609 |