Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | JTF64_RS06785 | Genome accession | NZ_CP070339 |
| Coordinates | 1365245..1365523 (-) | Length | 92 a.a. |
| NCBI ID | WP_098900139.1 | Uniprot ID | - |
| Organism | Bacillus cereus strain VKM B-370 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1332781..1375941 | 1365245..1365523 | within | 0 |
Gene organization within MGE regions
Location: 1332781..1375941
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JTF64_RS06595 (JTF64_06575) | - | 1332781..1333716 (-) | 936 | WP_098438056.1 | N-acetylmuramoyl-L-alanine amidase | - |
| JTF64_RS06600 (JTF64_06580) | - | 1333716..1334141 (-) | 426 | WP_097890570.1 | phage holin family protein | - |
| JTF64_RS06605 (JTF64_06585) | - | 1334181..1338212 (-) | 4032 | WP_098438058.1 | phage tail spike protein | - |
| JTF64_RS06610 (JTF64_06590) | - | 1338209..1339690 (-) | 1482 | WP_089455241.1 | distal tail protein Dit | - |
| JTF64_RS06615 (JTF64_06595) | - | 1339705..1342323 (-) | 2619 | WP_205190503.1 | phage tail tape measure protein | - |
| JTF64_RS06620 (JTF64_06600) | - | 1342486..1343448 (-) | 963 | WP_097890571.1 | hypothetical protein | - |
| JTF64_RS06625 (JTF64_06605) | - | 1343535..1344815 (-) | 1281 | Protein_1330 | phage tail tape measure protein | - |
| JTF64_RS06630 | - | 1344830..1345006 (-) | 177 | WP_170951593.1 | hypothetical protein | - |
| JTF64_RS06635 (JTF64_06610) | - | 1345036..1345353 (-) | 318 | WP_065484711.1 | hypothetical protein | - |
| JTF64_RS06640 (JTF64_06615) | - | 1345399..1346004 (-) | 606 | WP_006921167.1 | major tail protein | - |
| JTF64_RS06645 (JTF64_06620) | - | 1346005..1346364 (-) | 360 | WP_097890573.1 | DUF3168 domain-containing protein | - |
| JTF64_RS06650 (JTF64_06625) | - | 1346361..1346795 (-) | 435 | WP_000763220.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| JTF64_RS06655 (JTF64_06630) | - | 1346788..1347111 (-) | 324 | WP_098438064.1 | phage head closure protein | - |
| JTF64_RS06660 (JTF64_06635) | - | 1347098..1347385 (-) | 288 | WP_097890575.1 | head-tail connector protein | - |
| JTF64_RS06665 (JTF64_06640) | - | 1347406..1348578 (-) | 1173 | WP_097890576.1 | phage major capsid protein | - |
| JTF64_RS06670 (JTF64_06645) | - | 1348616..1349326 (-) | 711 | WP_097890577.1 | head maturation protease, ClpP-related | - |
| JTF64_RS06675 (JTF64_06650) | - | 1349313..1350566 (-) | 1254 | WP_000577424.1 | phage portal protein | - |
| JTF64_RS06680 (JTF64_06655) | - | 1350583..1350744 (-) | 162 | WP_001211535.1 | hypothetical protein | - |
| JTF64_RS06685 (JTF64_06660) | - | 1350755..1352449 (-) | 1695 | WP_097890578.1 | terminase TerL endonuclease subunit | - |
| JTF64_RS06690 (JTF64_06665) | - | 1352451..1352954 (-) | 504 | WP_097890579.1 | phage terminase small subunit P27 family | - |
| JTF64_RS06695 (JTF64_06670) | - | 1353084..1353461 (-) | 378 | WP_205190504.1 | HNH endonuclease | - |
| JTF64_RS06700 (JTF64_06675) | - | 1353451..1353705 (-) | 255 | WP_205190505.1 | hypothetical protein | - |
| JTF64_RS06705 (JTF64_06680) | - | 1353844..1354053 (-) | 210 | WP_205190506.1 | hypothetical protein | - |
| JTF64_RS06710 (JTF64_06685) | - | 1354423..1355373 (-) | 951 | WP_205190507.1 | hypothetical protein | - |
| JTF64_RS06715 (JTF64_06690) | - | 1355568..1356110 (-) | 543 | WP_098328208.1 | site-specific integrase | - |
| JTF64_RS06720 (JTF64_06695) | - | 1356110..1356592 (-) | 483 | WP_000166190.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| JTF64_RS06725 (JTF64_06700) | - | 1356620..1356790 (-) | 171 | WP_086404552.1 | hypothetical protein | - |
| JTF64_RS06730 (JTF64_06705) | - | 1356906..1357028 (-) | 123 | WP_049106871.1 | DUF3983 domain-containing protein | - |
| JTF64_RS06735 (JTF64_06710) | - | 1357067..1357240 (-) | 174 | WP_170952463.1 | hypothetical protein | - |
| JTF64_RS06740 (JTF64_06715) | - | 1357247..1357387 (-) | 141 | WP_170952464.1 | hypothetical protein | - |
| JTF64_RS06745 (JTF64_06720) | - | 1357509..1357817 (-) | 309 | WP_000367355.1 | hypothetical protein | - |
| JTF64_RS06750 (JTF64_06725) | - | 1358498..1359814 (+) | 1317 | WP_098311398.1 | collagen-like protein | - |
| JTF64_RS06755 (JTF64_06730) | - | 1360935..1361507 (+) | 573 | WP_001163834.1 | cupin domain-containing protein | - |
| JTF64_RS06760 (JTF64_06735) | - | 1362237..1363310 (+) | 1074 | Protein_1357 | exosporium leader peptide-containing protein | - |
| JTF64_RS06765 (JTF64_06740) | - | 1363927..1364409 (-) | 483 | WP_098900142.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| JTF64_RS06770 (JTF64_06745) | - | 1364430..1364681 (-) | 252 | WP_098900141.1 | helix-turn-helix domain containing protein | - |
| JTF64_RS06775 (JTF64_06750) | - | 1364707..1364874 (-) | 168 | WP_006923988.1 | DUF3954 domain-containing protein | - |
| JTF64_RS06780 (JTF64_06755) | - | 1364893..1365252 (-) | 360 | WP_098900140.1 | cell division protein SepF | - |
| JTF64_RS06785 (JTF64_06760) | abrB | 1365245..1365523 (-) | 279 | WP_098900139.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| JTF64_RS06790 (JTF64_06765) | - | 1365541..1365735 (-) | 195 | WP_098900138.1 | hypothetical protein | - |
| JTF64_RS06795 (JTF64_06770) | - | 1365795..1366106 (+) | 312 | WP_098900137.1 | hypothetical protein | - |
| JTF64_RS06800 (JTF64_06775) | - | 1366093..1366263 (-) | 171 | WP_179862650.1 | hypothetical protein | - |
| JTF64_RS06805 (JTF64_06780) | - | 1366278..1367081 (-) | 804 | WP_205190549.1 | ATP-binding protein | - |
| JTF64_RS06810 (JTF64_06785) | - | 1367050..1367784 (-) | 735 | WP_205190508.1 | DnaD domain protein | - |
| JTF64_RS06815 (JTF64_06790) | - | 1367789..1367965 (-) | 177 | WP_001241129.1 | hypothetical protein | - |
| JTF64_RS06820 (JTF64_06795) | - | 1367995..1368159 (-) | 165 | WP_000390298.1 | hypothetical protein | - |
| JTF64_RS06825 (JTF64_06800) | - | 1368159..1368425 (-) | 267 | WP_000522024.1 | helix-turn-helix domain-containing protein | - |
| JTF64_RS29630 | - | 1368484..1368567 (-) | 84 | WP_225913362.1 | hypothetical protein | - |
| JTF64_RS06835 (JTF64_06810) | - | 1368641..1368937 (-) | 297 | WP_205190509.1 | helix-turn-helix transcriptional regulator | - |
| JTF64_RS06840 (JTF64_06815) | - | 1369121..1369471 (+) | 351 | WP_000425256.1 | helix-turn-helix transcriptional regulator | - |
| JTF64_RS06845 (JTF64_06820) | - | 1369732..1369887 (-) | 156 | WP_205190554.1 | hypothetical protein | - |
| JTF64_RS06850 (JTF64_06825) | - | 1369914..1371122 (-) | 1209 | WP_205190510.1 | AimR family lysis-lysogeny pheromone receptor | - |
| JTF64_RS06855 (JTF64_06830) | - | 1371787..1372896 (+) | 1110 | WP_205190511.1 | tyrosine-type recombinase/integrase | - |
| JTF64_RS06860 (JTF64_06835) | - | 1372935..1373636 (-) | 702 | WP_205190512.1 | DUF3962 domain-containing protein | - |
| JTF64_RS06865 (JTF64_06840) | - | 1373934..1374419 (-) | 486 | WP_002082715.1 | hypothetical protein | - |
| JTF64_RS06870 (JTF64_06845) | - | 1374629..1374763 (-) | 135 | Protein_1379 | site-specific integrase | - |
| JTF64_RS06875 (JTF64_06850) | - | 1374913..1375230 (-) | 318 | WP_205190513.1 | heterocycloanthracin/sonorensin family bacteriocin | - |
| JTF64_RS06880 (JTF64_06855) | - | 1375678..1375941 (-) | 264 | WP_002082716.1 | DUF3937 domain-containing protein | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10206.69 Da Isoelectric Point: 4.6882
>NTDB_id=539200 JTF64_RS06785 WP_098900139.1 1365245..1365523(-) (abrB) [Bacillus cereus strain VKM B-370]
MKNTGVTRKVDELGRVVIPVELRRTLGIVEGTTLDFHVEGENIVLRKYENSCFVTGEVSDSNMELLDGRMFLSKEGATEL
LDILEKSGIVHG
MKNTGVTRKVDELGRVVIPVELRRTLGIVEGTTLDFHVEGENIVLRKYENSCFVTGEVSDSNMELLDGRMFLSKEGATEL
LDILEKSGIVHG
Nucleotide
Download Length: 279 bp
>NTDB_id=539200 JTF64_RS06785 WP_098900139.1 1365245..1365523(-) (abrB) [Bacillus cereus strain VKM B-370]
ATGAAAAACACAGGTGTTACAAGAAAAGTGGACGAGCTAGGGCGTGTAGTAATACCAGTAGAGTTACGCAGAACTTTAGG
GATTGTCGAAGGAACGACACTAGATTTTCATGTCGAGGGTGAAAACATTGTTCTAAGAAAATATGAAAACTCATGCTTTG
TGACGGGTGAAGTTTCTGACTCAAACATGGAATTGCTGGATGGAAGAATGTTTCTAAGTAAAGAAGGAGCAACTGAATTA
CTGGACATTCTTGAAAAGAGTGGAATAGTACATGGCTAA
ATGAAAAACACAGGTGTTACAAGAAAAGTGGACGAGCTAGGGCGTGTAGTAATACCAGTAGAGTTACGCAGAACTTTAGG
GATTGTCGAAGGAACGACACTAGATTTTCATGTCGAGGGTGAAAACATTGTTCTAAGAAAATATGAAAACTCATGCTTTG
TGACGGGTGAAGTTTCTGACTCAAACATGGAATTGCTGGATGGAAGAATGTTTCTAAGTAAAGAAGGAGCAACTGAATTA
CTGGACATTCTTGAAAAGAGTGGAATAGTACATGGCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
59.036 |
90.217 |
0.533 |