Detailed information    

insolico Bioinformatically predicted

Overview


Name   sxy/tfoX   Type   Regulator
Locus tag   JSQ86_RS14985 Genome accession   NZ_CP069707
Coordinates   3044519..3045148 (-) Length   209 a.a.
NCBI ID   WP_000839153.1    Uniprot ID   A0A9Q6Y251
Organism   Escherichia coli strain E41     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3018740..3063937 3044519..3045148 within 0


Gene organization within MGE regions


Location: 3018740..3063937
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JSQ86_RS14800 (JSQ86_14800) - 3019085..3019360 (-) 276 WP_123008118.1 hypothetical protein -
  JSQ86_RS24360 - 3019334..3019456 (+) 123 WP_258742594.1 hypothetical protein -
  JSQ86_RS14805 (JSQ86_14805) - 3019996..3020499 (-) 504 WP_251302273.1 FkbM family methyltransferase -
  JSQ86_RS14810 (JSQ86_14810) - 3020411..3020902 (-) 492 WP_204098010.1 FkbM family methyltransferase -
  JSQ86_RS14815 (JSQ86_14815) hokD 3021027..3021182 (-) 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD -
  JSQ86_RS14820 (JSQ86_14820) - 3021428..3021532 (-) 105 WP_001278454.1 hypothetical protein -
  JSQ86_RS14825 (JSQ86_14825) - 3021666..3022646 (+) 981 WP_000019441.1 IS5-like element ISKpn26 family transposase -
  JSQ86_RS24440 - 3022848..3023186 (-) 339 WP_000726005.1 DUF551 domain-containing protein -
  JSQ86_RS24200 - 3023286..3023381 (-) 96 Protein_2935 hypothetical protein -
  JSQ86_RS24205 - 3023592..3023717 (-) 126 Protein_2936 hypothetical protein -
  JSQ86_RS14835 (JSQ86_14835) - 3023728..3023991 (-) 264 WP_000224233.1 hypothetical protein -
  JSQ86_RS14840 (JSQ86_14840) - 3023993..3024210 (-) 218 Protein_2938 DUF4014 family protein -
  JSQ86_RS14845 (JSQ86_14845) - 3024243..3024455 (-) 213 WP_000935421.1 hypothetical protein -
  JSQ86_RS14850 (JSQ86_14850) - 3024506..3024862 (-) 357 WP_024249813.1 hypothetical protein -
  JSQ86_RS14855 (JSQ86_14855) - 3024920..3025342 (-) 423 WP_001151130.1 DUF977 family protein -
  JSQ86_RS14860 (JSQ86_14860) - 3025383..3026453 (-) 1071 WP_191642465.1 phage replisome organizer -
  JSQ86_RS14865 (JSQ86_14865) - 3026525..3026950 (-) 426 WP_001678565.1 toxin YdaT family protein -
  JSQ86_RS14870 (JSQ86_14870) - 3026947..3027249 (-) 303 WP_204098011.1 transcriptional regulator -
  JSQ86_RS14875 (JSQ86_14875) - 3027347..3027718 (+) 372 WP_122985828.1 hypothetical protein -
  JSQ86_RS14880 (JSQ86_14880) - 3027739..3027930 (+) 192 WP_001302048.1 hypothetical protein -
  JSQ86_RS14885 (JSQ86_14885) - 3027932..3028210 (+) 279 WP_001303511.1 type II toxin-antitoxin system RelE/ParE family toxin -
  JSQ86_RS14890 (JSQ86_14890) ydfA 3028502..3028657 (+) 156 WP_032154077.1 DUF1391 family protein -
  JSQ86_RS14895 (JSQ86_14895) - 3028798..3029424 (+) 627 WP_203373727.1 hypothetical protein -
  JSQ86_RS14900 (JSQ86_14900) - 3029425..3029634 (-) 210 WP_033813301.1 hypothetical protein -
  JSQ86_RS14905 (JSQ86_14905) dicB 3030202..3030390 (+) 189 WP_086625363.1 cell division inhibition protein DicB -
  JSQ86_RS14910 (JSQ86_14910) - 3030387..3030590 (+) 204 WP_086625364.1 DUF1482 family protein -
  JSQ86_RS14915 (JSQ86_14915) - 3030671..3033154 (+) 2484 WP_204098012.1 exonuclease -
  JSQ86_RS14920 (JSQ86_14920) - 3033221..3033472 (+) 252 WP_000273167.1 DUF4224 domain-containing protein -
  JSQ86_RS14925 (JSQ86_14925) - 3033441..3034460 (+) 1020 WP_001364438.1 tyrosine-type recombinase/integrase -
  JSQ86_RS14930 (JSQ86_14930) yccA 3034868..3035527 (+) 660 WP_000375136.1 FtsH protease modulator YccA -
  JSQ86_RS14935 (JSQ86_14935) tusE 3035618..3035947 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  JSQ86_RS14940 (JSQ86_14940) yccX 3035944..3036222 (-) 279 WP_000048252.1 acylphosphatase -
  JSQ86_RS14945 (JSQ86_14945) rlmI 3036317..3037507 (+) 1191 WP_000116297.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  JSQ86_RS14950 (JSQ86_14950) hspQ 3037565..3037882 (+) 318 WP_001295356.1 heat shock protein HspQ -
  JSQ86_RS14955 (JSQ86_14955) yccU 3037927..3038340 (-) 414 WP_001301418.1 CoA-binding protein -
  JSQ86_RS14960 (JSQ86_14960) yccT 3038513..3039175 (+) 663 WP_000847791.1 DUF2057 family protein -
  JSQ86_RS14965 (JSQ86_14965) mgsA 3039271..3039729 (+) 459 WP_000424181.1 methylglyoxal synthase -
  JSQ86_RS14970 (JSQ86_14970) helD 3039761..3041815 (-) 2055 WP_001295354.1 DNA helicase IV -
  JSQ86_RS14975 (JSQ86_14975) yccF 3041938..3042384 (+) 447 WP_001261235.1 YccF domain-containing protein -
  JSQ86_RS14980 (JSQ86_14980) yccS 3042394..3044556 (+) 2163 WP_000875061.1 YccS family putative transporter -
  JSQ86_RS14985 (JSQ86_14985) sxy/tfoX 3044519..3045148 (-) 630 WP_000839153.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  JSQ86_RS14990 (JSQ86_14990) sulA 3045367..3045876 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  JSQ86_RS14995 (JSQ86_14995) ompA 3046233..3047273 (+) 1041 WP_000750416.1 porin OmpA -
  JSQ86_RS15000 (JSQ86_15000) matP 3047349..3047801 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  JSQ86_RS15005 (JSQ86_15005) ycbZ 3047987..3049747 (+) 1761 WP_000156518.1 Lon protease family protein -
  JSQ86_RS15010 (JSQ86_15010) fabA 3049816..3050334 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  JSQ86_RS15015 (JSQ86_15015) rmf 3050404..3050571 (-) 168 WP_000828648.1 ribosome modulation factor -
  JSQ86_RS15020 (JSQ86_15020) pqiC 3050827..3051390 (-) 564 WP_000759120.1 membrane integrity-associated transporter subunit PqiC -
  JSQ86_RS15025 (JSQ86_15025) pqiB 3051387..3053027 (-) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  JSQ86_RS15030 (JSQ86_15030) pqiA 3053032..3054285 (-) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  JSQ86_RS15035 (JSQ86_15035) uup 3054415..3056322 (-) 1908 WP_000053099.1 ABC transporter ATP-binding protein -
  JSQ86_RS15040 (JSQ86_15040) rlmKL 3056334..3058442 (-) 2109 WP_204098013.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  JSQ86_RS15045 (JSQ86_15045) ycbX 3058686..3059795 (+) 1110 WP_000212426.1 6-N-hydroxylaminopurine resistance protein YcbX -
  JSQ86_RS15050 (JSQ86_15050) zapC 3059792..3060334 (-) 543 WP_001338438.1 cell division protein ZapC -
  JSQ86_RS15055 (JSQ86_15055) pyrD 3060508..3061518 (-) 1011 WP_001295352.1 quinone-dependent dihydroorotate dehydrogenase -
  JSQ86_RS15060 (JSQ86_15060) ycbF 3061629..3062366 (-) 738 WP_001111465.1 fimbrial chaperone -
  JSQ86_RS15065 (JSQ86_15065) ycbV 3062332..3062847 (-) 516 WP_000919497.1 fimbrial protein -
  JSQ86_RS15070 (JSQ86_15070) ycbU 3062855..3063397 (-) 543 WP_000730614.1 fimbrial protein -

Sequence


Protein


Download         Length: 209 a.a.        Molecular weight: 24147.02 Da        Isoelectric Point: 9.2180

>NTDB_id=536493 JSQ86_RS14985 WP_000839153.1 3044519..3045148(-) (sxy/tfoX) [Escherichia coli strain E41]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=536493 JSQ86_RS14985 WP_000839153.1 3044519..3045148(-) (sxy/tfoX) [Escherichia coli strain E41]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

100

1