Detailed information    

insolico Bioinformatically predicted

Overview


Name   HI0659   Type   Machinery gene
Locus tag   I6J38_RS04945 Genome accession   NZ_CP069558
Coordinates   1013054..1013350 (-) Length   98 a.a.
NCBI ID   WP_020997975.1    Uniprot ID   U2ZJ70
Organism   Streptococcus constellatus strain FDAARGOS_1208     
Function   DNA uptake (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1008622..1029844 1013054..1013350 within 0


Gene organization within MGE regions


Location: 1008622..1029844
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I6J38_RS04925 (I6J38_04925) recR 1008622..1009218 (-) 597 WP_006268506.1 recombination mediator RecR -
  I6J38_RS04930 (I6J38_04930) pbp2b 1009229..1011289 (-) 2061 WP_020997973.1 penicillin-binding protein PBP2B -
  I6J38_RS04935 (I6J38_04935) - 1011653..1011820 (-) 168 WP_006268192.1 hypothetical protein -
  I6J38_RS04940 (I6J38_04940) - 1011827..1013032 (-) 1206 WP_020997974.1 hypothetical protein -
  I6J38_RS04945 (I6J38_04945) HI0659 1013054..1013350 (-) 297 WP_020997975.1 helix-turn-helix domain-containing protein Machinery gene
  I6J38_RS04950 (I6J38_04950) - 1013340..1013705 (-) 366 WP_006268450.1 type II toxin-antitoxin system RelE/ParE family toxin -
  I6J38_RS04955 (I6J38_04955) - 1013771..1014046 (-) 276 WP_006268376.1 terminase small subunit -
  I6J38_RS04960 (I6J38_04960) - 1014126..1014356 (-) 231 WP_022525741.1 hypothetical protein -
  I6J38_RS04965 (I6J38_04965) - 1014595..1015005 (-) 411 WP_006268286.1 hypothetical protein -
  I6J38_RS04970 (I6J38_04970) - 1014986..1015468 (-) 483 WP_006268241.1 hypothetical protein -
  I6J38_RS04975 (I6J38_04975) - 1015487..1015867 (-) 381 WP_006268172.1 hypothetical protein -
  I6J38_RS04980 (I6J38_04980) - 1015892..1016101 (-) 210 WP_006268092.1 hypothetical protein -
  I6J38_RS04985 (I6J38_04985) - 1016181..1016357 (-) 177 WP_006267997.1 hypothetical protein -
  I6J38_RS04990 (I6J38_04990) - 1016677..1017168 (-) 492 WP_006268458.1 hypothetical protein -
  I6J38_RS04995 (I6J38_04995) - 1017487..1018341 (-) 855 WP_006268118.1 ATP-binding protein -
  I6J38_RS05000 (I6J38_05000) - 1018353..1019174 (-) 822 WP_006268372.1 DnaD domain protein -
  I6J38_RS05005 (I6J38_05005) - 1019167..1019361 (-) 195 WP_006268001.1 hypothetical protein -
  I6J38_RS05010 (I6J38_05010) - 1019373..1019639 (-) 267 WP_006268135.1 HTH domain-containing protein -
  I6J38_RS05015 (I6J38_05015) - 1019650..1019844 (-) 195 WP_006268448.1 hypothetical protein -
  I6J38_RS05020 (I6J38_05020) - 1020050..1020238 (-) 189 WP_006268000.1 hypothetical protein -
  I6J38_RS05025 (I6J38_05025) - 1020409..1020996 (+) 588 WP_020997978.1 helix-turn-helix domain-containing protein -
  I6J38_RS05030 (I6J38_05030) - 1021142..1022305 (+) 1164 Protein_1009 tyrosine-type recombinase/integrase -
  I6J38_RS05035 (I6J38_05035) - 1022463..1023155 (-) 693 WP_003036126.1 phosphoglycerate mutase -
  I6J38_RS05040 (I6J38_05040) - 1023293..1023754 (-) 462 WP_003035860.1 Fur family transcriptional regulator -
  I6J38_RS05045 (I6J38_05045) - 1023923..1024198 (-) 276 WP_003036014.1 HU family DNA-binding protein -
  I6J38_RS05050 (I6J38_05050) - 1024327..1025160 (-) 834 WP_020997980.1 DegV family protein -
  I6J38_RS05055 (I6J38_05055) - 1025396..1026349 (+) 954 WP_020997981.1 ABC transporter permease -
  I6J38_RS05060 (I6J38_05060) - 1026342..1027304 (+) 963 WP_006268532.1 iron chelate uptake ABC transporter family permease subunit -
  I6J38_RS05065 (I6J38_05065) - 1027305..1028057 (+) 753 WP_006268271.1 ABC transporter ATP-binding protein -
  I6J38_RS05070 (I6J38_05070) - 1028079..1029050 (+) 972 WP_020997982.1 siderophore ABC transporter substrate-binding protein -
  I6J38_RS05075 (I6J38_05075) - 1029113..1029844 (-) 732 WP_020997983.1 metallophosphoesterase -

Sequence


Protein


Download         Length: 98 a.a.        Molecular weight: 10755.42 Da        Isoelectric Point: 4.8898

>NTDB_id=535519 I6J38_RS04945 WP_020997975.1 1013054..1013350(-) (HI0659) [Streptococcus constellatus strain FDAARGOS_1208]
MKNSAIGSNWKDVRAELFSKEEILESDMRVAIMSELIEARNERGISQKKLEELSGVSQPVIARMETGKTSPQLDTVLKVL
ASLGKTLAVVPLEGEQIS

Nucleotide


Download         Length: 297 bp        

>NTDB_id=535519 I6J38_RS04945 WP_020997975.1 1013054..1013350(-) (HI0659) [Streptococcus constellatus strain FDAARGOS_1208]
ATGAAAAATAGTGCAATTGGTAGTAACTGGAAAGATGTAAGAGCTGAGTTATTCAGCAAAGAAGAAATTTTAGAAAGTGA
TATGCGTGTGGCTATCATGAGTGAGCTTATCGAGGCTAGGAATGAAAGGGGTATTAGTCAGAAAAAACTAGAGGAGCTGA
GTGGTGTTAGTCAGCCAGTCATAGCTAGAATGGAGACAGGAAAAACAAGCCCACAGCTTGATACCGTTTTAAAAGTATTA
GCAAGTCTTGGTAAGACGTTGGCTGTTGTACCCTTAGAGGGCGAACAGATAAGCTAG

Domains


Predicted by InterproScan.

(37-88)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB U2ZJ70

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  HI0659 Haemophilus influenzae Rd KW20

59.341

92.857

0.551