Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   JQN69_RS11965 Genome accession   NZ_CP069430
Coordinates   2493246..2493623 (-) Length   125 a.a.
NCBI ID   WP_012117980.1    Uniprot ID   -
Organism   Bacillus velezensis strain TB918     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2488246..2498623
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JQN69_RS11925 (JQN69_11925) - 2488744..2489538 (+) 795 WP_007408330.1 YqhG family protein -
  JQN69_RS11930 (JQN69_11930) sinI 2489715..2489888 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  JQN69_RS11935 (JQN69_11935) sinR 2489922..2490257 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  JQN69_RS11940 (JQN69_11940) - 2490305..2491090 (-) 786 WP_007408329.1 TasA family protein -
  JQN69_RS11945 (JQN69_11945) - 2491155..2491739 (-) 585 WP_015240205.1 signal peptidase I -
  JQN69_RS11950 (JQN69_11950) tapA 2491711..2492382 (-) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  JQN69_RS11955 (JQN69_11955) - 2492641..2492970 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  JQN69_RS11960 (JQN69_11960) - 2493010..2493189 (-) 180 WP_003153093.1 YqzE family protein -
  JQN69_RS11965 (JQN69_11965) comGG 2493246..2493623 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  JQN69_RS11970 (JQN69_11970) comGF 2493624..2494124 (-) 501 WP_257899725.1 competence type IV pilus minor pilin ComGF -
  JQN69_RS11975 (JQN69_11975) comGE 2494033..2494347 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  JQN69_RS11980 (JQN69_11980) comGD 2494331..2494768 (-) 438 WP_043020787.1 competence type IV pilus minor pilin ComGD Machinery gene
  JQN69_RS11985 (JQN69_11985) comGC 2494758..2495066 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  JQN69_RS11990 (JQN69_11990) comGB 2495071..2496108 (-) 1038 WP_094031834.1 competence type IV pilus assembly protein ComGB Machinery gene
  JQN69_RS11995 (JQN69_11995) comGA 2496095..2497165 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  JQN69_RS12000 (JQN69_12000) - 2497359..2498309 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14195.14 Da        Isoelectric Point: 9.7165

>NTDB_id=534612 JQN69_RS11965 WP_012117980.1 2493246..2493623(-) (comGG) [Bacillus velezensis strain TB918]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGVLLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=534612 JQN69_RS11965 WP_012117980.1 2493246..2493623(-) (comGG) [Bacillus velezensis strain TB918]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
GTCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
TGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512