Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | LA346_RS07460 | Genome accession | NZ_CP083627 |
| Coordinates | 1422037..1422186 (+) | Length | 49 a.a. |
| NCBI ID | WP_001809846.1 | Uniprot ID | Q00MV6 |
| Organism | Streptococcus pneumoniae strain FDAARGOS_1508 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1417037..1427186
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LA346_RS11010 | comA/nlmT | 1417083..1417670 (-) | 588 | WP_001810228.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| LA346_RS07415 (LA346_07415) | blpI | 1417952..1418149 (+) | 198 | WP_001093259.1 | bacteriocin-like peptide BlpI | - |
| LA346_RS07420 (LA346_07420) | blpJ | 1418616..1418885 (+) | 270 | WP_001093248.1 | bacteriocin-like peptide BlpJ | - |
| LA346_RS07425 (LA346_07425) | blpU | 1418954..1419184 (+) | 231 | WP_000379964.1 | bacteriocin-like peptide BlpU | - |
| LA346_RS07430 (LA346_07430) | - | 1419187..1419306 (+) | 120 | WP_000346298.1 | PncF family bacteriocin immunity protein | - |
| LA346_RS07435 (LA346_07435) | - | 1419603..1419767 (+) | 165 | WP_000727118.1 | hypothetical protein | - |
| LA346_RS07440 (LA346_07440) | - | 1419764..1420168 (+) | 405 | WP_000846944.1 | hypothetical protein | - |
| LA346_RS07445 (LA346_07445) | - | 1420366..1421170 (+) | 805 | Protein_1440 | IS5 family transposase | - |
| LA346_RS07450 (LA346_07450) | blpM | 1421320..1421574 (+) | 255 | WP_000379879.1 | two-peptide bacteriocin subunit BlpM | - |
| LA346_RS07455 (LA346_07455) | blpN | 1421590..1421793 (+) | 204 | WP_001099492.1 | two-peptide bacteriocin subunit BlpN | - |
| LA346_RS07460 (LA346_07460) | cipB | 1422037..1422186 (+) | 150 | WP_001809846.1 | bacteriocin-like peptide BlpO | Regulator |
| LA346_RS07465 (LA346_07465) | - | 1422290..1422409 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| LA346_RS07470 (LA346_07470) | - | 1423195..1423614 (+) | 420 | WP_000877385.1 | hypothetical protein | - |
| LA346_RS07475 (LA346_07475) | - | 1423629..1424318 (+) | 690 | WP_000760521.1 | CPBP family intramembrane glutamic endopeptidase | - |
| LA346_RS07480 (LA346_07480) | blpZ | 1424360..1424593 (+) | 234 | WP_000276498.1 | immunity protein BlpZ | - |
| LA346_RS07485 (LA346_07485) | - | 1424924..1426270 (+) | 1347 | WP_001808790.1 | IS1380-like element ISSpn5 family transposase | - |
| LA346_RS07490 (LA346_07490) | - | 1426452..1427063 (+) | 612 | WP_000638370.1 | CPBP family intramembrane glutamic endopeptidase | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5149.92 Da Isoelectric Point: 4.0439
>NTDB_id=532955 LA346_RS07460 WP_001809846.1 1422037..1422186(+) (cipB) [Streptococcus pneumoniae strain FDAARGOS_1508]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=532955 LA346_RS07460 WP_001809846.1 1422037..1422186(+) (cipB) [Streptococcus pneumoniae strain FDAARGOS_1508]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
53.061 |
100 |
0.531 |