Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | K8Z53_RS05970 | Genome accession | NZ_CP083238 |
| Coordinates | 1080336..1080476 (-) | Length | 46 a.a. |
| NCBI ID | WP_003184860.1 | Uniprot ID | A0ABM6LMF9 |
| Organism | Bacillus licheniformis strain 2709 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1075336..1085476
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K8Z53_RS05945 (K8Z53_05870) | - | 1075656..1076045 (-) | 390 | WP_009329508.1 | hotdog fold thioesterase | - |
| K8Z53_RS05950 (K8Z53_05875) | comA | 1076062..1076700 (-) | 639 | WP_003184849.1 | response regulator transcription factor | Regulator |
| K8Z53_RS05955 (K8Z53_05880) | comP | 1076787..1079087 (-) | 2301 | WP_009329509.1 | ATP-binding protein | Regulator |
| K8Z53_RS05960 (K8Z53_05885) | comX | 1079089..1079262 (-) | 174 | WP_142782424.1 | competence pheromone ComX | - |
| K8Z53_RS05965 (K8Z53_05890) | comQ | 1079266..1080147 (-) | 882 | WP_009329511.1 | polyprenyl synthetase family protein | Regulator |
| K8Z53_RS05970 (K8Z53_05895) | degQ | 1080336..1080476 (-) | 141 | WP_003184860.1 | degradation enzyme regulation protein DegQ | Regulator |
| K8Z53_RS05975 (K8Z53_05900) | - | 1080962..1081309 (+) | 348 | WP_009329512.1 | hypothetical protein | - |
| K8Z53_RS05980 (K8Z53_05905) | - | 1081352..1082571 (-) | 1220 | Protein_1167 | EAL and HDOD domain-containing protein | - |
| K8Z53_RS05985 (K8Z53_05910) | - | 1082750..1084159 (-) | 1410 | WP_228767691.1 | nicotinate phosphoribosyltransferase | - |
| K8Z53_RS05990 (K8Z53_05915) | - | 1084237..1084788 (-) | 552 | WP_003184868.1 | cysteine hydrolase family protein | - |
| K8Z53_RS05995 (K8Z53_05920) | - | 1084973..1085374 (-) | 402 | WP_003184870.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5747.56 Da Isoelectric Point: 8.4596
>NTDB_id=531178 K8Z53_RS05970 WP_003184860.1 1080336..1080476(-) (degQ) [Bacillus licheniformis strain 2709]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
Nucleotide
Download Length: 141 bp
>NTDB_id=531178 K8Z53_RS05970 WP_003184860.1 1080336..1080476(-) (degQ) [Bacillus licheniformis strain 2709]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
71.429 |
91.304 |
0.652 |