NTDB

Overview

Name	comGD	Type	Machinery gene
Locus tag	K8Z53_RS02315	Genome accession	NZ_CP083238
Coordinates	406257..406694 (-)	Length	145 a.a.
NCBI ID	WP_009327905.1	Uniprot ID	Q8VQ70
Organism	Bacillus licheniformis strain 2709
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 401257..411694

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
K8Z53_RS02265 (K8Z53_02240)	sinI	401433..401609 (+)	177	WP_003183444.1	anti-repressor SinI	Regulator
K8Z53_RS02270 (K8Z53_02245)	sinR	401643..401978 (+)	336	WP_006637528.1	transcriptional regulator SinR	Regulator
K8Z53_RS02275 (K8Z53_02250)	tasA	402083..402877 (-)	795	WP_142782737.1	biofilm matrix protein TasA	-
K8Z53_RS02280 (K8Z53_02255)	sipW	402951..403535 (-)	585	WP_003183449.1	signal peptidase I SipW	-
K8Z53_RS02285 (K8Z53_02260)	tapA	403532..404260 (-)	729	WP_003183451.1	amyloid fiber anchoring/assembly protein TapA	-
K8Z53_RS02290 (K8Z53_02265)	-	404537..404857 (+)	321	WP_003183454.1	YqzG/YhdC family protein	-
K8Z53_RS02295 (K8Z53_02270)	-	404881..405063 (-)	183	WP_003183456.1	YqzE family protein	-
K8Z53_RS02300 (K8Z53_02275)	comGG	405151..405516 (-)	366	WP_003183459.1	competence type IV pilus minor pilin ComGG	-
K8Z53_RS02305 (K8Z53_02280)	comGF	405529..406017 (-)	489	WP_011201694.1	competence type IV pilus minor pilin ComGF	-
K8Z53_RS02310 (K8Z53_02285)	comGE	405926..406273 (-)	348	WP_009327907.1	competence type IV pilus minor pilin ComGE	-
K8Z53_RS02315 (K8Z53_02290)	comGD	406257..406694 (-)	438	WP_009327905.1	competence type IV pilus minor pilin ComGD	Machinery gene
K8Z53_RS02320 (K8Z53_02295)	comGC	406700..406993 (-)	294	WP_003183466.1	competence type IV pilus major pilin ComGC	Machinery gene
K8Z53_RS02325 (K8Z53_02300)	comGB	407007..408041 (-)	1035	WP_011198115.1	competence type IV pilus assembly protein ComGB	Machinery gene
K8Z53_RS02330 (K8Z53_02305)	comGA	408031..409095 (-)	1065	WP_003183477.1	competence type IV pilus ATPase ComGA	Machinery gene
K8Z53_RS02335 (K8Z53_02310)	-	409252..410091 (-)	840	WP_061576836.1	STAS domain-containing protein	-
K8Z53_RS02345 (K8Z53_02320)	-	410314..410709 (-)	396	WP_142782738.1	Spx/MgsR family RNA polymerase-binding regulatory protein	-
K8Z53_RS02350 (K8Z53_02325)	-	410918..411163 (+)	246	WP_003183483.1	DUF2626 domain-containing protein	-

Sequence

Protein

Download Length: 145 a.a. Molecular weight: 16249.07 Da Isoelectric Point: 9.6739

                                >NTDB_id=531149 K8Z53_RS02315 WP_009327905.1 406257..406694(-) (comGD) [Bacillus licheniformis strain 2709]

MNQKGFTLLESLTVLMIGSIMFSLLFALLPPIYEKRIVQHFVSQLEEDLLYAQQTALVRHTTVKVQFDFAGCRYIMKHSD

EGSSPELVRTYSCNIAIKKSTLKPILTFNPSGVPNQGGKIVIDTQHASFILTIYLGSGKINVQKK

Nucleotide

Download Length: 438 bp

                                >NTDB_id=531149 K8Z53_RS02315 WP_009327905.1 406257..406694(-) (comGD) [Bacillus licheniformis strain 2709]

ATGAATCAAAAAGGATTTACGCTTTTGGAAAGTTTAACTGTATTGATGATCGGTTCTATTATGTTCTCTCTTCTCTTTGC

TCTACTGCCTCCCATTTATGAAAAAAGAATCGTTCAGCACTTTGTCTCACAGCTTGAAGAGGATTTGCTTTACGCTCAGC

AGACGGCTCTCGTCCGCCATACGACGGTTAAGGTGCAGTTTGACTTTGCCGGCTGCCGCTATATCATGAAGCATTCGGAC

GAAGGCTCATCGCCTGAACTGGTCAGGACATACAGCTGCAATATCGCAATCAAAAAGTCGACGCTCAAACCAATTCTTAC

TTTTAATCCAAGCGGTGTTCCGAATCAAGGGGGAAAGATCGTGATCGATACACAGCATGCCTCTTTTATACTGACGATCT

ATTTAGGAAGCGGAAAGATTAATGTTCAAAAAAAATAA

Domains

Predicted by InterProScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(2-25)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	Q8VQ70

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGD	Bacillus subtilis subsp. subtilis str. 168	39.86	98.621	0.393

Detailed information NTG0531149