Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | JM956_RS13750 | Genome accession | NZ_CP068719 |
| Coordinates | 2673429..2673707 (+) | Length | 92 a.a. |
| NCBI ID | WP_202822737.1 | Uniprot ID | - |
| Organism | Bacillus cereus strain 21155 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2663410..2704045 | 2673429..2673707 | within | 0 |
Gene organization within MGE regions
Location: 2663410..2704045
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JM956_RS13675 | tenA | 2663410..2664099 (+) | 690 | WP_000144512.1 | thiaminase II | - |
| JM956_RS13680 | - | 2664497..2664760 (+) | 264 | WP_002082716.1 | DUF3937 domain-containing protein | - |
| JM956_RS13685 | - | 2665108..2665242 (+) | 135 | Protein_2641 | site-specific integrase | - |
| JM956_RS13690 | - | 2665450..2665935 (+) | 486 | WP_002164034.1 | hypothetical protein | - |
| JM956_RS13695 | - | 2666245..2666946 (+) | 702 | WP_202822732.1 | DUF3962 domain-containing protein | - |
| JM956_RS13700 | - | 2666985..2668094 (-) | 1110 | WP_202822733.1 | tyrosine-type recombinase/integrase | - |
| JM956_RS13705 | - | 2668641..2669792 (+) | 1152 | WP_063264024.1 | AimR family lysis-lysogeny pheromone receptor | - |
| JM956_RS13710 | - | 2669830..2669976 (+) | 147 | WP_000720921.1 | hypothetical protein | - |
| JM956_RS32130 | - | 2670131..2670259 (+) | 129 | WP_000836783.1 | hypothetical protein | - |
| JM956_RS13715 | - | 2670296..2670649 (-) | 354 | WP_000491236.1 | helix-turn-helix transcriptional regulator | - |
| JM956_RS13720 | - | 2670850..2671041 (+) | 192 | WP_000854271.1 | helix-turn-helix transcriptional regulator | - |
| JM956_RS13725 | - | 2671096..2671362 (+) | 267 | WP_000522030.1 | helix-turn-helix domain-containing protein | - |
| JM956_RS13730 | - | 2671362..2671526 (+) | 165 | WP_202822734.1 | hypothetical protein | - |
| JM956_RS13735 | - | 2671584..2672648 (+) | 1065 | WP_202822735.1 | DnaD domain protein | - |
| JM956_RS13740 | - | 2672645..2673055 (+) | 411 | WP_202822736.1 | hypothetical protein | - |
| JM956_RS13745 | - | 2673088..2673342 (-) | 255 | WP_098223762.1 | hypothetical protein | - |
| JM956_RS13750 | abrB | 2673429..2673707 (+) | 279 | WP_202822737.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| JM956_RS13755 | - | 2673700..2674059 (+) | 360 | WP_001125973.1 | hypothetical protein | - |
| JM956_RS13760 | - | 2674079..2674243 (+) | 165 | WP_000711472.1 | DUF3954 domain-containing protein | - |
| JM956_RS13765 | - | 2674269..2674742 (+) | 474 | WP_001272177.1 | hypothetical protein | - |
| JM956_RS13770 | - | 2674763..2675278 (+) | 516 | WP_202822738.1 | dUTP diphosphatase | - |
| JM956_RS13775 | - | 2675282..2675758 (+) | 477 | WP_202822739.1 | hypothetical protein | - |
| JM956_RS13780 | - | 2675951..2676169 (+) | 219 | WP_202822740.1 | hypothetical protein | - |
| JM956_RS13785 | - | 2676445..2676723 (+) | 279 | WP_202822741.1 | hypothetical protein | - |
| JM956_RS13790 | - | 2679331..2679540 (+) | 210 | WP_202822742.1 | hypothetical protein | - |
| JM956_RS13795 | - | 2679813..2679983 (+) | 171 | WP_202822743.1 | hypothetical protein | - |
| JM956_RS13800 | - | 2680004..2680474 (+) | 471 | WP_086395682.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| JM956_RS13805 | - | 2680471..2681013 (+) | 543 | WP_001028518.1 | tyrosine-type recombinase/integrase | - |
| JM956_RS13810 | - | 2681204..2681452 (+) | 249 | WP_202822744.1 | hypothetical protein | - |
| JM956_RS13815 | - | 2681644..2682900 (-) | 1257 | WP_202822745.1 | hypothetical protein | - |
| JM956_RS13820 | - | 2682931..2683107 (+) | 177 | WP_202822746.1 | hypothetical protein | - |
| JM956_RS13825 | - | 2683745..2684479 (+) | 735 | WP_202822747.1 | hypothetical protein | - |
| JM956_RS13830 | - | 2684522..2684746 (+) | 225 | WP_202822748.1 | hypothetical protein | - |
| JM956_RS13835 | - | 2684881..2685150 (+) | 270 | WP_202822749.1 | HNH endonuclease signature motif containing protein | - |
| JM956_RS13840 | - | 2685153..2685467 (+) | 315 | WP_202822750.1 | hypothetical protein | - |
| JM956_RS13845 | - | 2685574..2685894 (+) | 321 | WP_001228915.1 | P27 family phage terminase small subunit | - |
| JM956_RS13850 | - | 2685884..2687560 (+) | 1677 | WP_238363695.1 | terminase TerL endonuclease subunit | - |
| JM956_RS13855 | - | 2687575..2688741 (+) | 1167 | WP_202822751.1 | phage portal protein | - |
| JM956_RS13860 | - | 2688728..2689468 (+) | 741 | WP_238363687.1 | head maturation protease, ClpP-related | - |
| JM956_RS13865 | - | 2689497..2690648 (+) | 1152 | WP_000153085.1 | phage major capsid protein | - |
| JM956_RS13870 | - | 2690668..2690964 (+) | 297 | WP_076775023.1 | hypothetical protein | - |
| JM956_RS13875 | - | 2690945..2691301 (+) | 357 | WP_000243384.1 | phage head closure protein | - |
| JM956_RS13880 | - | 2691294..2691695 (+) | 402 | WP_238363688.1 | hypothetical protein | - |
| JM956_RS13885 | - | 2691682..2692110 (+) | 429 | WP_081395933.1 | hypothetical protein | - |
| JM956_RS13890 | - | 2692111..2692695 (+) | 585 | WP_202822752.1 | phage tail protein | - |
| JM956_RS13895 | - | 2692767..2693228 (+) | 462 | WP_086396588.1 | hypothetical protein | - |
| JM956_RS13900 | - | 2693407..2694987 (+) | 1581 | WP_202822753.1 | hypothetical protein | - |
| JM956_RS13905 | - | 2695497..2698331 (+) | 2835 | WP_238363696.1 | hypothetical protein | - |
| JM956_RS13910 | - | 2698333..2699016 (+) | 684 | WP_086396591.1 | distal tail protein Dit | - |
| JM956_RS13915 | - | 2699016..2701421 (+) | 2406 | WP_098558467.1 | phage tail spike protein | - |
| JM956_RS13920 | - | 2701436..2702617 (+) | 1182 | WP_086396593.1 | BppU family phage baseplate upper protein | - |
| JM956_RS13925 | - | 2702698..2702937 (+) | 240 | WP_001115042.1 | hemolysin XhlA family protein | - |
| JM956_RS13930 | - | 2702980..2703210 (+) | 231 | WP_000787573.1 | phage holin | - |
| JM956_RS13935 | - | 2703227..2704045 (+) | 819 | WP_202822755.1 | GH25 family lysozyme | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10213.84 Da Isoelectric Point: 6.4658
>NTDB_id=530694 JM956_RS13750 WP_202822737.1 2673429..2673707(+) (abrB) [Bacillus cereus strain 21155]
MKTTGVVRKVDELGRVVIPVELRRTLGIAEGTALDFHVYGENIILKKQEKSCFVTGEVSESNIELLDGRMFLSKKGASEL
LDLLQKNVTEHA
MKTTGVVRKVDELGRVVIPVELRRTLGIAEGTALDFHVYGENIILKKQEKSCFVTGEVSESNIELLDGRMFLSKKGASEL
LDLLQKNVTEHA
Nucleotide
Download Length: 279 bp
>NTDB_id=530694 JM956_RS13750 WP_202822737.1 2673429..2673707(+) (abrB) [Bacillus cereus strain 21155]
ATGAAAACCACAGGTGTTGTAAGAAAAGTCGATGAGTTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTGGG
TATTGCTGAAGGTACTGCACTAGACTTTCATGTTTATGGAGAAAATATCATTTTGAAAAAACAAGAAAAATCATGCTTTG
TAACGGGCGAAGTGTCTGAATCCAACATTGAATTGTTAGATGGCCGAATGTTTTTGAGTAAGAAAGGTGCAAGTGAGTTA
CTGGACCTCCTTCAAAAGAATGTGACGGAACATGCCTAA
ATGAAAACCACAGGTGTTGTAAGAAAAGTCGATGAGTTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTGGG
TATTGCTGAAGGTACTGCACTAGACTTTCATGTTTATGGAGAAAATATCATTTTGAAAAAACAAGAAAAATCATGCTTTG
TAACGGGCGAAGTGTCTGAATCCAACATTGAATTGTTAGATGGCCGAATGTTTTTGAGTAAGAAAGGTGCAAGTGAGTTA
CTGGACCTCCTTCAAAAGAATGTGACGGAACATGCCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
59.77 |
94.565 |
0.565 |