Detailed information    

insolico Bioinformatically predicted

Overview

Name   comX   Type   Regulator
Locus tag   BAJP3042_RS15090 Genome accession   NZ_CP082243
Coordinates   3101163..3101339 (-) Length   58 a.a.
NCBI ID   WP_007408675.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain JP3042     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context

Location: 3096163..3106339
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAJP3042_RS15060 (BAJP3042_15060) - 3096546..3097022 (+) 477 WP_007408672.1 Na+/H+ antiporter subunit E -
  BAJP3042_RS15065 (BAJP3042_15065) - 3097022..3097306 (+) 285 WP_012118311.1 Na(+)/H(+) antiporter subunit F1 -
  BAJP3042_RS15070 (BAJP3042_15070) mnhG 3097290..3097664 (+) 375 WP_003152056.1 monovalent cation/H(+) antiporter subunit G -
  BAJP3042_RS15075 (BAJP3042_15075) - 3097704..3098087 (-) 384 WP_012118312.1 hotdog fold thioesterase -
  BAJP3042_RS15080 (BAJP3042_15080) comA 3098109..3098753 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  BAJP3042_RS15085 (BAJP3042_15085) comP 3098834..3101143 (-) 2310 WP_020954299.1 histidine kinase Regulator
  BAJP3042_RS15090 (BAJP3042_15090) comX 3101163..3101339 (-) 177 WP_007408675.1 competence pheromone ComX Regulator
  BAJP3042_RS15095 (BAJP3042_15095) comQ 3101339..3102223 (-) 885 WP_032865221.1 class 1 isoprenoid biosynthesis enzyme Regulator
  BAJP3042_RS15100 (BAJP3042_15100) degQ 3102408..3102548 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  BAJP3042_RS15105 (BAJP3042_15105) - 3103014..3103355 (+) 342 WP_025285192.1 hypothetical protein -
  BAJP3042_RS15110 (BAJP3042_15110) - 3103362..3104585 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  BAJP3042_RS15115 (BAJP3042_15115) - 3104715..3106181 (-) 1467 WP_222835292.1 nicotinate phosphoribosyltransferase -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6644.64 Da        Isoelectric Point: 4.6082

>NTDB_id=527627 BAJP3042_RS15090 WP_007408675.1 3101163..3101339(-) (comX) [Bacillus amyloliquefaciens strain JP3042]
MQDLINYILKYPEVLKKLKVNEASLLGYDSGITQILINSFEESSIVKNDGKIEQWEKG

Nucleotide


Download         Length: 177 bp        

>NTDB_id=527627 BAJP3042_RS15090 WP_007408675.1 3101163..3101339(-) (comX) [Bacillus amyloliquefaciens strain JP3042]
ATGCAGGATTTGATCAATTATATATTGAAATATCCGGAAGTGTTAAAAAAATTAAAAGTCAATGAAGCAAGTTTATTAGG
CTATGATTCAGGTATTACTCAAATATTAATCAATTCATTTGAAGAATCTTCAATTGTGAAAAACGATGGAAAAATAGAGC
AATGGGAAAAAGGATGA

Domains

Predicted by InterProScan.

Bacillus competence pheromone ComX (ComX)

(1-55)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

47.273

94.828

0.448