Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   JHX84_RS13630 Genome accession   NZ_CP067043
Coordinates   2629745..2629918 (-) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain 19573-3     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2624745..2634918
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JHX84_RS13580 (JHX84_13575) comGD 2624866..2625303 (+) 438 WP_003153088.1 competence type IV pilus minor pilin ComGD Machinery gene
  JHX84_RS13585 (JHX84_13580) comGE 2625287..2625601 (+) 315 WP_046341385.1 competence type IV pilus minor pilin ComGE -
  JHX84_RS13590 (JHX84_13585) comGF 2625615..2626010 (+) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  JHX84_RS13595 (JHX84_13590) comGG 2626011..2626388 (+) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  JHX84_RS13600 (JHX84_13595) - 2626445..2626624 (+) 180 WP_003153093.1 YqzE family protein -
  JHX84_RS13605 (JHX84_13600) - 2626664..2626993 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  JHX84_RS13610 (JHX84_13605) tapA 2627252..2627923 (+) 672 WP_046341384.1 amyloid fiber anchoring/assembly protein TapA -
  JHX84_RS13615 (JHX84_13610) sipW 2627895..2628479 (+) 585 WP_003153100.1 signal peptidase I SipW -
  JHX84_RS13620 (JHX84_13615) tasA 2628543..2629328 (+) 786 WP_003153102.1 biofilm matrix protein TasA -
  JHX84_RS13625 (JHX84_13620) sinR 2629376..2629711 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  JHX84_RS13630 (JHX84_13625) sinI 2629745..2629918 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  JHX84_RS13635 (JHX84_13630) - 2630095..2630889 (-) 795 WP_069473503.1 YqhG family protein -
  JHX84_RS13640 (JHX84_13635) - 2630907..2632577 (-) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  JHX84_RS13645 (JHX84_13640) gcvT 2633000..2634100 (+) 1101 WP_069473502.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=524659 JHX84_RS13630 WP_003153105.1 2629745..2629918(-) (sinI) [Bacillus velezensis strain 19573-3]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=524659 JHX84_RS13630 WP_003153105.1 2629745..2629918(-) (sinI) [Bacillus velezensis strain 19573-3]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702