Detailed information    

insolico Bioinformatically predicted

Overview


Name   abrB   Type   Regulator
Locus tag   BTG_RS27670 Genome accession   NC_018500
Coordinates   5457451..5457729 (+) Length   92 a.a.
NCBI ID   WP_000799103.1    Uniprot ID   A0A9W5VI42
Organism   Bacillus thuringiensis HD-771     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Genomic Context


Location: 5452451..5462729
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BTG_RS36115 (BTG_27970) - 5452974..5453123 (+) 150 WP_000712277.1 hypothetical protein -
  BTG_RS27625 (BTG_27975) - 5453129..5453479 (-) 351 WP_001015842.1 helix-turn-helix domain-containing protein -
  BTG_RS27630 (BTG_27980) - 5453700..5453900 (+) 201 WP_000773129.1 helix-turn-helix domain-containing protein -
  BTG_RS27635 (BTG_27985) - 5453965..5454726 (+) 762 WP_001071339.1 Rha family transcriptional regulator -
  BTG_RS27640 (BTG_27990) - 5454765..5455025 (+) 261 WP_000626614.1 hypothetical protein -
  BTG_RS36120 (BTG_27995) - 5455038..5455202 (+) 165 WP_000390315.1 hypothetical protein -
  BTG_RS36125 (BTG_28000) - 5455232..5455408 (+) 177 WP_000364160.1 hypothetical protein -
  BTG_RS27655 (BTG_28005) - 5455414..5456298 (+) 885 WP_000005659.1 phage replisome organizer N-terminal domain-containing protein -
  BTG_RS27660 (BTG_28010) - 5456313..5457227 (+) 915 WP_001171107.1 AAA family ATPase -
  BTG_RS27665 (BTG_28015) - 5457240..5457434 (+) 195 WP_000332459.1 hypothetical protein -
  BTG_RS27670 (BTG_28020) abrB 5457451..5457729 (+) 279 WP_000799103.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  BTG_RS27675 (BTG_28025) - 5457722..5458081 (+) 360 WP_001125975.1 hypothetical protein -
  BTG_RS34900 (BTG_28030) - 5458101..5458268 (+) 168 WP_000717826.1 DUF3954 domain-containing protein -
  BTG_RS27685 (BTG_28035) - 5458294..5458545 (+) 252 WP_000109497.1 hypothetical protein -
  BTG_RS36600 - 5458615..5458797 (+) 183 WP_085959129.1 glyoxalase -
  BTG_RS27690 (BTG_28040) - 5458857..5459057 (+) 201 WP_000133156.1 hypothetical protein -
  BTG_RS27695 (BTG_28045) - 5459100..5459285 (+) 186 WP_000473094.1 hypothetical protein -
  BTG_RS27700 (BTG_28050) - 5459300..5459485 (+) 186 WP_014894885.1 hypothetical protein -
  BTG_RS36760 - 5459522..5459653 (+) 132 WP_258035171.1 hypothetical protein -
  BTG_RS27705 (BTG_28055) - 5459708..5460448 (+) 741 WP_000783007.1 DNA cytosine methyltransferase -
  BTG_RS36130 - 5460483..5460644 (+) 162 WP_000371315.1 hypothetical protein -
  BTG_RS27710 (BTG_28060) - 5460679..5460957 (+) 279 WP_000873128.1 hypothetical protein -
  BTG_RS27715 (BTG_28065) - 5461077..5461427 (+) 351 WP_001206928.1 YopX family protein -
  BTG_RS34915 (BTG_28070) - 5461564..5461686 (+) 123 WP_014894886.1 DUF3983 domain-containing protein -
  BTG_RS36135 (BTG_28075) - 5461802..5461972 (+) 171 WP_000866138.1 hypothetical protein -
  BTG_RS27725 (BTG_28080) - 5462000..5462482 (+) 483 WP_000166182.1 ArpU family phage packaging/lysis transcriptional regulator -

Sequence


Protein


Download         Length: 92 a.a.        Molecular weight: 10141.74 Da        Isoelectric Point: 6.4668

>NTDB_id=52457 BTG_RS27670 WP_000799103.1 5457451..5457729(+) (abrB) [Bacillus thuringiensis HD-771]
MKNTGVVRKVDELGRVVIPVELRRTLGIAEGTAVDFHVYGENIILKKQEKSCFVTGEVSDSNIELLGGRMFLSKEGALEL
LNSLEKSVKEHA

Nucleotide


Download         Length: 279 bp        

>NTDB_id=52457 BTG_RS27670 WP_000799103.1 5457451..5457729(+) (abrB) [Bacillus thuringiensis HD-771]
ATGAAAAACACAGGTGTTGTAAGAAAAGTTGATGAGCTAGGACGTGTAGTAATTCCGGTAGAGTTACGCAGGACTTTGGG
TATTGCTGAAGGTACAGCAGTAGACTTTCATGTTTATGGAGAAAACATCATTTTGAAAAAACAAGAAAAGTCATGCTTTG
TAACTGGTGAAGTATCTGATTCCAACATCGAATTGTTAGGTGGCCGAATGTTTTTGAGTAAGGAAGGAGCACTTGAGTTA
CTTAATTCTCTTGAAAAGAGTGTGAAGGAACATGCCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

58.242

98.913

0.576


Multiple sequence alignment