Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   U471_RS02000 Genome accession   NC_022653
Coordinates   397251..397370 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   A7Z1C5
Organism   Bacillus amyloliquefaciens CC178     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 392251..402370
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  U471_RS01985 (U471_03620) - 393863..394546 (+) 684 WP_007410267.1 response regulator transcription factor -
  U471_RS01990 (U471_03630) - 394533..395966 (+) 1434 WP_162303988.1 sensor histidine kinase -
  U471_RS01995 (U471_03650) rapC 396119..397267 (+) 1149 WP_012116798.1 Rap family tetratricopeptide repeat protein Regulator
  U471_RS02000 (U471_03660) phrC 397251..397370 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  U471_RS19085 - 397519..397629 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  U471_RS02005 (U471_03680) - 397709..399073 (-) 1365 WP_012116801.1 aspartate kinase -
  U471_RS02010 (U471_03700) ceuB 399487..400440 (+) 954 WP_012116802.1 ABC transporter permease Machinery gene
  U471_RS02015 (U471_03710) - 400430..401377 (+) 948 WP_012116803.1 iron chelate uptake ABC transporter family permease subunit -
  U471_RS02020 (U471_03720) - 401371..402129 (+) 759 WP_012116804.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=52302 U471_RS02000 WP_003156334.1 397251..397370(+) (phrC) [Bacillus amyloliquefaciens CC178]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=52302 U471_RS02000 WP_003156334.1 397251..397370(+) (phrC) [Bacillus amyloliquefaciens CC178]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z1C5

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment