Detailed information NTG0522076

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: JGZ36_RS07185
• Genome accession: NZ_CP066718
• Coordinates: 1466643..1466966 (+)
• Length: 107 a.a.
• NCBI ID: WP_015729165.1
• Uniprot ID: -
• Organism: Staphylococcus pseudintermedius strain DG064
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1461643..1471966

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
JGZ36_RS07155 (JGZ36_07155)	-	1462015..1463166 (+)	1152	WP_015729170.1	SNF2-related protein	-
JGZ36_RS14640 (JGZ36_07160)	-	1463166..1464086 (+)	921	WP_199274061.1	phosphoadenosine phosphosulfate reductase family protein	-
JGZ36_RS14645 (JGZ36_07165)	-	1464020..1464457 (+)	438	WP_199274096.1	DUF3440 domain-containing protein	-
JGZ36_RS07170 (JGZ36_07170)	-	1464451..1464957 (+)	507	WP_198463136.1	ParB/RepB/Spo0J family partition protein	-
JGZ36_RS07175 (JGZ36_07175)	comGA	1465070..1465594 (+)	525	WP_256726570.1	ATPase, T2SS/T4P/T4SS family	Machinery gene
JGZ36_RS07180 (JGZ36_07180)	comGB	1465563..1466630 (+)	1068	WP_037542939.1	competence type IV pilus assembly protein ComGB	-
JGZ36_RS07185 (JGZ36_07185)	comGC	1466643..1466966 (+)	324	WP_015729165.1	competence type IV pilus major pilin ComGC	Machinery gene
JGZ36_RS07190 (JGZ36_07190)	comGD	1466944..1467384 (+)	441	WP_014613823.1	competence type IV pilus minor pilin ComGD	-
JGZ36_RS14650 (JGZ36_07195)	-	1467456..1467689 (+)	234	WP_014613824.1	hypothetical protein	-
JGZ36_RS07200 (JGZ36_07200)	-	1467595..1468080 (+)	486	WP_081378286.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	-
JGZ36_RS07205 (JGZ36_07205)	-	1468244..1468771 (+)	528	WP_014613826.1	shikimate kinase	-
JGZ36_RS07210 (JGZ36_07210)	gcvT	1468929..1470019 (+)	1091	Protein_1389	glycine cleavage system aminomethyltransferase GcvT	-
JGZ36_RS07215 (JGZ36_07215)	gcvPA	1470032..1471381 (+)	1350	WP_014613828.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 107 a.a.
• Molecular weight: 12027.26 Da
• Isoelectric Point: 9.0966

>NTDB_id=522076 JGZ36_RS07185 WP_015729165.1 1466643..1466966(+) (comGC) [Staphylococcus pseudintermedius strain DG064]
MIQQLKLKFNKKKGFTLIEMLLVLLIISVLLILIIPNIAKQSDHIQKTGCAAQLKMVDSQIEAYALKFNHKPNTIDDLVR
EGYIKESQKTCKSGEEITIRDGEAVAS

Nucleotide

• Length: 324 bp

>NTDB_id=522076 JGZ36_RS07185 WP_015729165.1 1466643..1466966(+) (comGC) [Staphylococcus pseudintermedius strain DG064]
ATGATTCAACAACTTAAATTAAAATTCAACAAAAAGAAAGGTTTTACATTAATTGAAATGCTACTTGTTCTGTTAATTAT
TAGTGTACTATTGATTCTCATTATCCCGAATATTGCTAAGCAGTCAGATCATATCCAAAAAACGGGTTGTGCTGCACAAT
TAAAAATGGTCGATAGTCAAATAGAAGCCTATGCTTTAAAGTTTAACCACAAACCGAATACGATTGATGATTTAGTTCGT
GAAGGCTACATTAAAGAAAGTCAAAAAACATGCAAATCAGGTGAAGAGATCACAATCAGAGATGGCGAAGCAGTTGCGTC
ATGA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (10-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	73.529	95.327	0.701
comGC	Staphylococcus aureus N315	73.529	95.327	0.701
comGC/cglC	Streptococcus mitis SK321	44.898	91.589	0.411
comGC/cglC	Streptococcus pneumoniae D39	43.878	91.589	0.402
comGC/cglC	Streptococcus pneumoniae TIGR4	43.878	91.589	0.402
comGC/cglC	Streptococcus pneumoniae Rx1	43.878	91.589	0.402
comGC/cglC	Streptococcus pneumoniae R6	43.878	91.589	0.402
comYC	Streptococcus suis isolate S10	53.846	72.897	0.393
comYC	Streptococcus gordonii str. Challis substr. CH1	49.398	77.57	0.383
comGC	Bacillus subtilis subsp. subtilis str. 168	44.565	85.981	0.383
comGC/cglC	Streptococcus mitis NCTC 12261	48.78	76.636	0.374
comGC	Lactococcus lactis subsp. cremoris KW2	48.78	76.636	0.374