Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   K3G18_RS12095 Genome accession   NZ_CP080629
Coordinates   2381005..2381178 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain YPS-32     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2376005..2386178
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K3G18_RS12080 (K3G18_12080) gcvT 2376804..2377892 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  K3G18_RS12085 (K3G18_12085) hepAA 2378334..2380007 (+) 1674 WP_029726726.1 DEAD/DEAH box helicase -
  K3G18_RS12090 (K3G18_12090) yqhG 2380028..2380822 (+) 795 WP_015714249.1 YqhG family protein -
  K3G18_RS12095 (K3G18_12095) sinI 2381005..2381178 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  K3G18_RS12100 (K3G18_12100) sinR 2381212..2381547 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  K3G18_RS12105 (K3G18_12105) tasA 2381640..2382425 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  K3G18_RS12110 (K3G18_12110) sipW 2382489..2383061 (-) 573 WP_072692741.1 signal peptidase I SipW -
  K3G18_RS12115 (K3G18_12115) tapA 2383045..2383806 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  K3G18_RS12120 (K3G18_12120) yqzG 2384078..2384404 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  K3G18_RS12125 (K3G18_12125) spoIITA 2384446..2384625 (-) 180 WP_029726723.1 YqzE family protein -
  K3G18_RS12130 (K3G18_12130) comGG 2384697..2385071 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  K3G18_RS12135 (K3G18_12135) comGF 2385072..2385455 (-) 384 WP_032722118.1 ComG operon protein ComGF Machinery gene
  K3G18_RS12140 (K3G18_12140) comGE 2385481..2385828 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=521273 K3G18_RS12095 WP_003230187.1 2381005..2381178(+) (sinI) [Bacillus subtilis strain YPS-32]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=521273 K3G18_RS12095 WP_003230187.1 2381005..2381178(+) (sinI) [Bacillus subtilis strain YPS-32]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1