Detailed information NTG0052027

Bioinformatically predicted

Overview

• Name: rcrR
• Type: Regulator
• Locus tag: SMUGS5_RS04140
• Genome accession: NC_018089
• Coordinates: 864291..864725 (+)
• Length: 144 a.a.
• NCBI ID: WP_002263292.1
• Uniprot ID: A0AAX1K4B8
• Organism: Streptococcus mutans GS-5
• Function: regulate competence (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Prophage	845334..868275	864291..864725	within	0

Gene organization within MGE regions

Location: 845334..868275

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SMUGS5_RS04070 (SMUGS5_03995)	-	845334..846539 (+)	1206	WP_014834939.1	CCA tRNA nucleotidyltransferase	-
SMUGS5_RS04075 (SMUGS5_04000)	-	846542..848410 (+)	1869	WP_014834940.1	ABC-F family ATP-binding cassette domain-containing protein	-
SMUGS5_RS04085 (SMUGS5_04010)	-	848866..850602 (+)	1737	WP_002283303.1	ABC transporter ATP-binding protein	-
SMUGS5_RS04090 (SMUGS5_04015)	-	850613..852385 (+)	1773	WP_014834941.1	ABC transporter ATP-binding protein	-
SMUGS5_RS04095 (SMUGS5_04020)	-	852501..853421 (+)	921	WP_014834942.1	AEC family transporter	-
SMUGS5_RS04100 (SMUGS5_04025)	gtfD	853641..858029 (+)	4389	WP_014834943.1	glucosyltransferase-S	-
SMUGS5_RS04105 (SMUGS5_04030)	-	858205..858714 (-)	510	WP_002274326.1	DUF308 domain-containing protein	-
SMUGS5_RS04110 (SMUGS5_04035)	gdhA	859476..860825 (+)	1350	WP_002263849.1	NADP-specific glutamate dehydrogenase	-
SMUGS5_RS04115 (SMUGS5_04040)	-	860935..861318 (-)	384	WP_014834944.1	DUF3021 family protein	-
SMUGS5_RS10425 (SMUGS5_04045)	queF	861427..861915 (-)	489	WP_002265143.1	preQ(1) synthase	-
SMUGS5_RS10430 (SMUGS5_04050)	queE	861928..862644 (-)	717	WP_014834945.1	7-carboxy-7-deazaguanine synthase QueE	-
SMUGS5_RS04130 (SMUGS5_04055)	queD	862641..863087 (-)	447	WP_002265145.1	6-carboxytetrahydropterin synthase QueD	-
SMUGS5_RS04135 (SMUGS5_04060)	queC	863062..863739 (-)	678	WP_014834946.1	7-cyano-7-deazaguanine synthase QueC	-
SMUGS5_RS04140 (SMUGS5_04065)	rcrR	864291..864725 (+)	435	WP_002263292.1	MarR family winged helix-turn-helix transcriptional regulator	Regulator
SMUGS5_RS04145 (SMUGS5_04070)	rcrP	864729..866531 (+)	1803	WP_002283869.1	ABC transporter ATP-binding protein	Regulator
SMUGS5_RS04150 (SMUGS5_04075)	rcrQ	866521..868275 (+)	1755	WP_014834947.1	ABC transporter ATP-binding protein	Regulator

Sequence

Protein

• Length: 144 a.a.
• Molecular weight: 16720.58 Da
• Isoelectric Point: 10.5126

>NTDB_id=52027 SMUGS5_RS04140 WP_002263292.1 864291..864725(+) (rcrR) [Streptococcus mutans GS-5]
MKEPFSEFKNLITATERYIQELSKSHGVEHLSGPQGWTVMFLKDNQGKEIFIKDIEKRLDISKSVTSNLIKRMEKNGFIS
VIPSRKDRRYKQIVLTPLGQEKAGKITVFLTDLKKLLLKDISQEDLSVARKVFKQIKQNLEKKE

Nucleotide

• Length: 435 bp

>NTDB_id=52027 SMUGS5_RS04140 WP_002263292.1 864291..864725(+) (rcrR) [Streptococcus mutans GS-5]
ATGAAGGAGCCTTTTAGTGAATTTAAAAACCTCATTACAGCAACAGAAAGATATATTCAAGAATTATCCAAAAGCCATGG
TGTTGAACATCTGTCCGGACCTCAGGGATGGACAGTTATGTTTTTAAAGGATAATCAAGGAAAGGAAATTTTTATTAAAG
ATATTGAAAAAAGGTTAGATATCTCAAAATCTGTGACCAGTAATCTCATTAAACGAATGGAAAAAAATGGTTTTATTTCT
GTTATTCCTTCCAGAAAAGACAGACGATACAAGCAAATTGTTTTAACGCCATTAGGTCAGGAAAAAGCTGGAAAAATAAC
TGTTTTTTTAACAGATCTTAAAAAGTTGCTTCTAAAAGATATTAGTCAGGAAGACTTATCAGTTGCTCGAAAGGTTTTTA
AACAAATCAAACAAAATTTAGAAAAGAAGGAGTAA

Domains

Predicted by InterproScan.

• MarR family (MarR_2) (31-89)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
rcrR	Streptococcus mutans UA159	100	100	1