Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   K0V03_RS01385 Genome accession   NZ_CP080508
Coordinates   238956..239129 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain HD15     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 233956..244129
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K0V03_RS01370 (K0V03_01370) gcvT 234755..235843 (-) 1089 WP_085186486.1 glycine cleavage system aminomethyltransferase GcvT -
  K0V03_RS01375 (K0V03_01375) hepAA 236285..237958 (+) 1674 WP_085186487.1 DEAD/DEAH box helicase -
  K0V03_RS01380 (K0V03_01380) yqhG 237979..238773 (+) 795 WP_003230200.1 YqhG family protein -
  K0V03_RS01385 (K0V03_01385) sinI 238956..239129 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  K0V03_RS01390 (K0V03_01390) sinR 239163..239498 (+) 336 WP_121548932.1 transcriptional regulator SinR Regulator
  K0V03_RS01395 (K0V03_01395) tasA 239591..240376 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  K0V03_RS01400 (K0V03_01400) sipW 240440..241012 (-) 573 WP_003230181.1 signal peptidase I SipW -
  K0V03_RS01405 (K0V03_01405) tapA 240996..241757 (-) 762 WP_085186488.1 amyloid fiber anchoring/assembly protein TapA -
  K0V03_RS01410 (K0V03_01410) yqzG 242028..242354 (+) 327 WP_085186489.1 YqzG/YhdC family protein -
  K0V03_RS01415 (K0V03_01415) spoIITA 242396..242575 (-) 180 WP_003230176.1 YqzE family protein -
  K0V03_RS01420 (K0V03_01420) comGG 242647..243021 (-) 375 WP_021480019.1 ComG operon protein ComGG Machinery gene
  K0V03_RS01425 (K0V03_01425) comGF 243022..243405 (-) 384 WP_085186490.1 ComG operon protein ComGF Machinery gene
  K0V03_RS01430 (K0V03_01430) comGE 243431..243778 (-) 348 WP_046160583.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=519964 K0V03_RS01385 WP_003230187.1 238956..239129(+) (sinI) [Bacillus subtilis strain HD15]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=519964 K0V03_RS01385 WP_003230187.1 238956..239129(+) (sinI) [Bacillus subtilis strain HD15]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1