Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   JEQ25_RS17020 Genome accession   NZ_CP066380
Coordinates   3221171..3221311 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain ID-A05     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3216171..3226311
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JEQ25_RS16995 (JEQ25_16870) yuxO 3216448..3216828 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  JEQ25_RS17000 (JEQ25_16875) comA 3216847..3217491 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  JEQ25_RS17005 (JEQ25_16880) comP 3217572..3219884 (-) 2313 WP_041332996.1 sensor histidine kinase Regulator
  JEQ25_RS17010 (JEQ25_16885) comX 3219900..3220121 (-) 222 WP_014480704.1 competence pheromone ComX -
  JEQ25_RS17015 (JEQ25_16890) - 3220123..3220986 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  JEQ25_RS17020 (JEQ25_16895) degQ 3221171..3221311 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  JEQ25_RS17025 (JEQ25_16900) - 3221533..3221658 (+) 126 WP_003228793.1 hypothetical protein -
  JEQ25_RS17030 (JEQ25_16905) - 3221773..3222141 (+) 369 WP_046381300.1 hypothetical protein -
  JEQ25_RS17035 (JEQ25_16910) pdeH 3222117..3223346 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  JEQ25_RS17040 (JEQ25_16915) pncB 3223483..3224955 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  JEQ25_RS17045 (JEQ25_16920) pncA 3224971..3225522 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  JEQ25_RS17050 (JEQ25_16925) yueI 3225619..3226017 (-) 399 WP_015251331.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=519849 JEQ25_RS17020 WP_003220708.1 3221171..3221311(-) (degQ) [Bacillus subtilis strain ID-A05]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=519849 JEQ25_RS17020 WP_003220708.1 3221171..3221311(-) (degQ) [Bacillus subtilis strain ID-A05]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1