Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   JEQ23_RS16895 Genome accession   NZ_CP066378
Coordinates   3325195..3325335 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain ID-A03     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3320195..3330335
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JEQ23_RS16870 (JEQ23_16700) - 3320535..3320918 (-) 384 WP_014418761.1 hotdog fold thioesterase -
  JEQ23_RS16875 (JEQ23_16705) comA 3320940..3321584 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  JEQ23_RS16880 (JEQ23_16710) comP 3321665..3323956 (-) 2292 WP_022553709.1 histidine kinase Regulator
  JEQ23_RS16885 (JEQ23_16715) comX 3323968..3324132 (-) 165 WP_007613432.1 competence pheromone ComX -
  JEQ23_RS16890 (JEQ23_16720) - 3324132..3325010 (-) 879 WP_032860494.1 polyprenyl synthetase family protein -
  JEQ23_RS16895 (JEQ23_16725) degQ 3325195..3325335 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  JEQ23_RS16900 (JEQ23_16730) - 3325801..3326142 (+) 342 WP_014418765.1 hypothetical protein -
  JEQ23_RS16905 (JEQ23_16735) - 3326149..3327372 (-) 1224 WP_014418766.1 EAL and HDOD domain-containing protein -
  JEQ23_RS16910 (JEQ23_16740) - 3327502..3328968 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  JEQ23_RS16915 (JEQ23_16745) - 3328986..3329537 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  JEQ23_RS16920 (JEQ23_16750) - 3329634..3330032 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=519691 JEQ23_RS16895 WP_003152043.1 3325195..3325335(-) (degQ) [Bacillus velezensis strain ID-A03]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=519691 JEQ23_RS16895 WP_003152043.1 3325195..3325335(-) (degQ) [Bacillus velezensis strain ID-A03]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891