Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   JEQ23_RS13860 Genome accession   NZ_CP066378
Coordinates   2747171..2747608 (-) Length   145 a.a.
NCBI ID   WP_007612572.1    Uniprot ID   -
Organism   Bacillus velezensis strain ID-A03     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2742171..2752608
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JEQ23_RS13810 (JEQ23_13655) sinI 2742554..2742727 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  JEQ23_RS13815 (JEQ23_13660) sinR 2742761..2743096 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  JEQ23_RS13820 (JEQ23_13665) - 2743144..2743929 (-) 786 WP_007408329.1 TasA family protein -
  JEQ23_RS13825 (JEQ23_13670) - 2743994..2744578 (-) 585 WP_022552967.1 signal peptidase I -
  JEQ23_RS13830 (JEQ23_13675) tapA 2744550..2745221 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  JEQ23_RS13835 (JEQ23_13680) - 2745480..2745809 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  JEQ23_RS13840 (JEQ23_13685) - 2745850..2746029 (-) 180 WP_022552966.1 YqzE family protein -
  JEQ23_RS13845 (JEQ23_13690) comGG 2746086..2746463 (-) 378 WP_022552965.1 competence type IV pilus minor pilin ComGG Machinery gene
  JEQ23_RS13850 (JEQ23_13695) comGF 2746464..2746859 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  JEQ23_RS13855 (JEQ23_13700) comGE 2746873..2747187 (-) 315 WP_021494312.1 competence type IV pilus minor pilin ComGE Machinery gene
  JEQ23_RS13860 (JEQ23_13705) comGD 2747171..2747608 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  JEQ23_RS13865 (JEQ23_13710) comGC 2747598..2747906 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  JEQ23_RS13870 (JEQ23_13715) comGB 2747911..2748948 (-) 1038 WP_022552962.1 competence type IV pilus assembly protein ComGB Machinery gene
  JEQ23_RS13875 (JEQ23_13720) comGA 2748935..2750005 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  JEQ23_RS13880 (JEQ23_13725) - 2750198..2751148 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -
  JEQ23_RS13885 (JEQ23_13730) - 2751294..2752595 (+) 1302 WP_022552961.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16254.76 Da        Isoelectric Point: 10.1850

>NTDB_id=519673 JEQ23_RS13860 WP_007612572.1 2747171..2747608(-) (comGD) [Bacillus velezensis strain ID-A03]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=519673 JEQ23_RS13860 WP_007612572.1 2747171..2747608(-) (comGD) [Bacillus velezensis strain ID-A03]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTACTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACGCTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATAACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

55.479

100

0.559