Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   JFU10_RS12485 Genome accession   NZ_CP066337
Coordinates   2566472..2566591 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain Mr12     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 2561472..2571591
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JFU10_RS12470 - 2563084..2563767 (+) 684 WP_007410267.1 response regulator transcription factor -
  JFU10_RS12475 - 2563754..2565187 (+) 1434 WP_198863488.1 sensor histidine kinase -
  JFU10_RS12480 rapC 2565340..2566488 (+) 1149 WP_003156336.1 Rap family tetratricopeptide repeat protein Regulator
  JFU10_RS12485 phrC 2566472..2566591 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  JFU10_RS12490 - 2566741..2566851 (-) 111 WP_369878517.1 YjcZ family sporulation protein -
  JFU10_RS12495 - 2566931..2568295 (-) 1365 WP_166706406.1 aspartate kinase -
  JFU10_RS12500 ceuB 2568710..2569663 (+) 954 WP_003156332.1 ABC transporter permease Machinery gene
  JFU10_RS12505 - 2569653..2570600 (+) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  JFU10_RS12510 - 2570594..2571352 (+) 759 WP_071392129.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=519337 JFU10_RS12485 WP_003156334.1 2566472..2566591(+) (phrC) [Bacillus velezensis strain Mr12]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=519337 JFU10_RS12485 WP_003156334.1 2566472..2566591(+) (phrC) [Bacillus velezensis strain Mr12]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718