Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | JC774_RS11090 | Genome accession | NZ_CP066179 |
| Coordinates | 2091501..2091788 (+) | Length | 95 a.a. |
| NCBI ID | WP_210351378.1 | Uniprot ID | - |
| Organism | Bacillus cytotoxicus strain SM2.8 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2079896..2122276 | 2091501..2091788 | within | 0 |
Gene organization within MGE regions
Location: 2079896..2122276
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JC774_RS10990 (JC774_10990) | - | 2079896..2081026 (-) | 1131 | WP_087099044.1 | site-specific integrase | - |
| JC774_RS10995 (JC774_10995) | - | 2081418..2081786 (-) | 369 | WP_087095270.1 | helix-turn-helix transcriptional regulator | - |
| JC774_RS11000 (JC774_11000) | - | 2082165..2083295 (+) | 1131 | WP_087095269.1 | AimR family lysis-lysogeny pheromone receptor | - |
| JC774_RS11005 (JC774_11005) | - | 2083344..2083484 (+) | 141 | WP_087095268.1 | complement C1q protein | - |
| JC774_RS22605 | - | 2083632..2083754 (+) | 123 | WP_256941502.1 | hypothetical protein | - |
| JC774_RS11010 (JC774_11010) | - | 2083790..2084149 (-) | 360 | WP_087095267.1 | helix-turn-helix transcriptional regulator | - |
| JC774_RS11015 (JC774_11015) | - | 2084342..2084536 (+) | 195 | WP_087095266.1 | helix-turn-helix transcriptional regulator | - |
| JC774_RS11020 (JC774_11020) | - | 2084622..2085398 (+) | 777 | WP_087095265.1 | phage antirepressor KilAC domain-containing protein | - |
| JC774_RS11025 (JC774_11025) | - | 2085415..2085624 (+) | 210 | WP_012095071.1 | helix-turn-helix domain-containing protein | - |
| JC774_RS11030 (JC774_11030) | - | 2085605..2085775 (+) | 171 | WP_179196723.1 | hypothetical protein | - |
| JC774_RS11035 (JC774_11035) | - | 2085772..2086092 (+) | 321 | WP_087099038.1 | hypothetical protein | - |
| JC774_RS11040 (JC774_11040) | - | 2086100..2086405 (+) | 306 | WP_176371945.1 | hypothetical protein | - |
| JC774_RS11045 (JC774_11045) | - | 2086581..2086796 (+) | 216 | WP_012095068.1 | hypothetical protein | - |
| JC774_RS11050 (JC774_11050) | - | 2086878..2087813 (+) | 936 | WP_087095263.1 | lambda-exonuclease family protein | - |
| JC774_RS11055 (JC774_11055) | - | 2087828..2088067 (+) | 240 | WP_041809942.1 | hypothetical protein | - |
| JC774_RS11060 (JC774_11060) | recT | 2088067..2088873 (+) | 807 | WP_210351374.1 | recombination protein RecT | - |
| JC774_RS11065 (JC774_11065) | - | 2089049..2089903 (+) | 855 | WP_210351375.1 | DnaD domain protein | - |
| JC774_RS11070 (JC774_11070) | - | 2089857..2090666 (+) | 810 | WP_244989696.1 | ATP-binding protein | - |
| JC774_RS11075 (JC774_11075) | - | 2090672..2090866 (+) | 195 | WP_041809938.1 | hypothetical protein | - |
| JC774_RS11080 (JC774_11080) | - | 2090847..2091329 (+) | 483 | WP_210351376.1 | YpiB family protein | - |
| JC774_RS11085 (JC774_11085) | - | 2091343..2091504 (+) | 162 | WP_210351377.1 | hypothetical protein | - |
| JC774_RS11090 (JC774_11090) | abrB | 2091501..2091788 (+) | 288 | WP_210351378.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| JC774_RS11095 (JC774_11095) | - | 2091785..2092237 (+) | 453 | WP_244989692.1 | MFS transporter | - |
| JC774_RS11100 (JC774_11100) | - | 2092383..2092904 (+) | 522 | WP_210351379.1 | dUTP diphosphatase | - |
| JC774_RS11105 (JC774_11105) | - | 2092901..2093314 (+) | 414 | WP_210351380.1 | DUF1064 domain-containing protein | - |
| JC774_RS11110 (JC774_11110) | - | 2093334..2094044 (+) | 711 | WP_210351381.1 | 2-methylcitrate dehydratase | - |
| JC774_RS22150 | - | 2094117..2094227 (+) | 111 | Protein_2070 | hypothetical protein | - |
| JC774_RS11115 (JC774_11115) | - | 2094309..2095007 (+) | 699 | WP_244989697.1 | hypothetical protein | - |
| JC774_RS11120 (JC774_11120) | - | 2095017..2095415 (+) | 399 | WP_210351383.1 | hypothetical protein | - |
| JC774_RS11125 (JC774_11125) | - | 2095408..2096136 (+) | 729 | WP_244989693.1 | sigma-70 family RNA polymerase sigma factor | - |
| JC774_RS11130 (JC774_11130) | - | 2096175..2096333 (+) | 159 | WP_210351384.1 | hypothetical protein | - |
| JC774_RS11135 (JC774_11135) | - | 2096417..2097142 (-) | 726 | WP_244989694.1 | glycosyltransferase family 2 protein | - |
| JC774_RS11140 (JC774_11140) | - | 2097444..2098301 (+) | 858 | WP_210351385.1 | DUF5677 domain-containing protein | - |
| JC774_RS11145 (JC774_11145) | - | 2098330..2098707 (+) | 378 | WP_210351386.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| JC774_RS11150 (JC774_11150) | - | 2099002..2099220 (+) | 219 | WP_012095046.1 | hypothetical protein | - |
| JC774_RS11155 (JC774_11155) | - | 2099226..2099417 (+) | 192 | WP_012095045.1 | hypothetical protein | - |
| JC774_RS11160 (JC774_11160) | - | 2099437..2099688 (+) | 252 | WP_210351387.1 | hypothetical protein | - |
| JC774_RS11165 (JC774_11165) | - | 2099685..2100068 (+) | 384 | WP_210351388.1 | HNH endonuclease | - |
| JC774_RS11170 (JC774_11170) | - | 2100168..2100653 (+) | 486 | WP_012095041.1 | phage terminase small subunit P27 family | - |
| JC774_RS11175 (JC774_11175) | - | 2100650..2102347 (+) | 1698 | WP_012095040.1 | terminase TerL endonuclease subunit | - |
| JC774_RS11180 (JC774_11180) | - | 2102363..2103673 (+) | 1311 | WP_012095039.1 | phage portal protein | - |
| JC774_RS11185 (JC774_11185) | - | 2103624..2104235 (+) | 612 | WP_210351402.1 | HK97 family phage prohead protease | - |
| JC774_RS11190 (JC774_11190) | - | 2104277..2105452 (+) | 1176 | WP_210351389.1 | phage major capsid protein | - |
| JC774_RS11195 (JC774_11195) | - | 2105470..2105760 (+) | 291 | WP_012095036.1 | head-tail connector protein | - |
| JC774_RS11200 (JC774_11200) | - | 2105757..2106080 (+) | 324 | WP_012095035.1 | phage head closure protein | - |
| JC774_RS11205 (JC774_11205) | - | 2106073..2106507 (+) | 435 | WP_210351390.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| JC774_RS11210 (JC774_11210) | - | 2106504..2106863 (+) | 360 | WP_012095033.1 | DUF3168 domain-containing protein | - |
| JC774_RS11215 (JC774_11215) | - | 2106864..2107475 (+) | 612 | WP_210351391.1 | major tail protein | - |
| JC774_RS11220 (JC774_11220) | - | 2107524..2107838 (+) | 315 | WP_012095031.1 | hypothetical protein | - |
| JC774_RS11225 (JC774_11225) | - | 2108055..2112095 (+) | 4041 | WP_210351392.1 | phage tail tape measure protein | - |
| JC774_RS11230 (JC774_11230) | - | 2112104..2113597 (+) | 1494 | WP_210351393.1 | distal tail protein Dit | - |
| JC774_RS11235 (JC774_11235) | - | 2113594..2117625 (+) | 4032 | WP_210351394.1 | phage tail spike protein | - |
| JC774_RS11240 (JC774_11240) | - | 2117667..2117903 (+) | 237 | WP_041809928.1 | hemolysin XhlA family protein | - |
| JC774_RS11245 (JC774_11245) | - | 2117903..2118142 (+) | 240 | WP_012095025.1 | hypothetical protein | - |
| JC774_RS11250 (JC774_11250) | - | 2118139..2119203 (+) | 1065 | WP_012095024.1 | N-acetylmuramoyl-L-alanine amidase | - |
| JC774_RS11255 (JC774_11255) | - | 2119239..2119565 (-) | 327 | WP_041809926.1 | hypothetical protein | - |
| JC774_RS11260 (JC774_11260) | - | 2119571..2119768 (-) | 198 | WP_012095022.1 | helix-turn-helix domain-containing protein | - |
| JC774_RS11265 (JC774_11265) | - | 2119928..2120230 (+) | 303 | WP_012095020.1 | hypothetical protein | - |
| JC774_RS11270 (JC774_11270) | - | 2120233..2120415 (+) | 183 | WP_012095019.1 | hypothetical protein | - |
| JC774_RS11275 (JC774_11275) | - | 2120533..2121714 (+) | 1182 | WP_012095018.1 | FtsK/SpoIIIE domain-containing protein | - |
| JC774_RS11280 (JC774_11280) | - | 2121656..2122276 (+) | 621 | WP_041809924.1 | replication-relaxation family protein | - |
Sequence
Protein
Download Length: 95 a.a. Molecular weight: 10520.19 Da Isoelectric Point: 7.1357
>NTDB_id=518156 JC774_RS11090 WP_210351378.1 2091501..2091788(+) (abrB) [Bacillus cytotoxicus strain SM2.8]
MKNTGIVRKVDNLGRVCIPKELRNTLGLYEGTSIEIHVDGENIVLTKHEKVCVVTGEASDTNIELFGGQVVLSRKGAKLL
IDSILREGEKRGWME
MKNTGIVRKVDNLGRVCIPKELRNTLGLYEGTSIEIHVDGENIVLTKHEKVCVVTGEASDTNIELFGGQVVLSRKGAKLL
IDSILREGEKRGWME
Nucleotide
Download Length: 288 bp
>NTDB_id=518156 JC774_RS11090 WP_210351378.1 2091501..2091788(+) (abrB) [Bacillus cytotoxicus strain SM2.8]
ATGAAAAACACTGGTATCGTAAGAAAAGTAGATAACCTTGGTCGTGTTTGTATTCCAAAAGAATTACGCAATACATTGGG
GCTGTATGAAGGAACATCGATAGAAATTCATGTGGATGGAGAAAACATTGTTCTTACGAAACATGAAAAAGTATGCGTCG
TAACTGGTGAAGCATCTGATACGAATATCGAGTTATTCGGTGGACAAGTAGTGCTCAGTCGGAAAGGTGCCAAATTGCTT
ATTGATTCAATCTTGCGAGAGGGCGAAAAGAGAGGGTGGATGGAATGA
ATGAAAAACACTGGTATCGTAAGAAAAGTAGATAACCTTGGTCGTGTTTGTATTCCAAAAGAATTACGCAATACATTGGG
GCTGTATGAAGGAACATCGATAGAAATTCATGTGGATGGAGAAAACATTGTTCTTACGAAACATGAAAAAGTATGCGTCG
TAACTGGTGAAGCATCTGATACGAATATCGAGTTATTCGGTGGACAAGTAGTGCTCAGTCGGAAAGGTGCCAAATTGCTT
ATTGATTCAATCTTGCGAGAGGGCGAAAAGAGAGGGTGGATGGAATGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
56.977 |
90.526 |
0.516 |