Detailed information NTG0517103

Bioinformatically predicted

Overview

• Name: HI0659
• Type: Machinery gene
• Locus tag: I6H74_RS05145
• Genome accession: NZ_CP066069
• Coordinates: 1036434..1036730 (+)
• Length: 98 a.a.
• NCBI ID: WP_027971722.1
• Uniprot ID: A0A9X8XHY7
• Organism: Streptococcus dysgalactiae strain FDAARGOS_1017
• Function: DNA uptake (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Prophage	1026890..1036444	1036434..1036730	flank	-10

Gene organization within MGE regions

Location: 1026890..1036730

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
I6H74_RS05050 (I6H74_05045)	-	1026890..1028053 (-)	1164	WP_115256955.1	site-specific integrase	-
I6H74_RS05055 (I6H74_05050)	-	1028130..1028654 (-)	525	WP_053042317.1	helix-turn-helix transcriptional regulator	-
I6H74_RS05060 (I6H74_05055)	-	1028828..1029016 (+)	189	WP_046177300.1	hypothetical protein	-
I6H74_RS05065 (I6H74_05060)	-	1029188..1029439 (+)	252	WP_046177301.1	hypothetical protein	-
I6H74_RS05070 (I6H74_05065)	-	1029442..1029645 (+)	204	WP_046177302.1	hypothetical protein	-
I6H74_RS05075 (I6H74_05070)	-	1029655..1029921 (+)	267	WP_000190301.1	hypothetical protein	-
I6H74_RS05080 (I6H74_05075)	-	1029932..1030090 (+)	159	WP_165742490.1	hypothetical protein	-
I6H74_RS05085 (I6H74_05080)	-	1030095..1030304 (+)	210	WP_115256954.1	hypothetical protein	-
I6H74_RS05090 (I6H74_05085)	-	1030291..1031112 (+)	822	WP_115256953.1	phage replisome organizer N-terminal domain-containing protein	-
I6H74_RS05095 (I6H74_05090)	-	1031124..1032008 (+)	885	WP_053042318.1	ATP-binding protein	-
I6H74_RS05100 (I6H74_05095)	-	1032258..1032440 (+)	183	WP_000273649.1	hypothetical protein	-
I6H74_RS05105 (I6H74_05100)	-	1032538..1032747 (+)	210	WP_046177305.1	hypothetical protein	-
I6H74_RS05115 (I6H74_05110)	-	1033992..1034378 (+)	387	WP_232619998.1	hypothetical protein	-
I6H74_RS05120 (I6H74_05115)	-	1034375..1034662 (+)	288	WP_046177192.1	hypothetical protein	-
I6H74_RS05125 (I6H74_05120)	-	1034701..1035129 (+)	429	WP_053042316.1	hypothetical protein	-
I6H74_RS05130 (I6H74_05125)	-	1035122..1035448 (+)	327	WP_046177191.1	hypothetical protein	-
I6H74_RS05135 (I6H74_05130)	-	1035466..1035861 (+)	396	WP_046177190.1	hypothetical protein	-
I6H74_RS05140 (I6H74_05135)	-	1036079..1036444 (+)	366	WP_046177189.1	type II toxin-antitoxin system RelE/ParE family toxin	-
I6H74_RS05145 (I6H74_05140)	HI0659	1036434..1036730 (+)	297	WP_027971722.1	helix-turn-helix transcriptional regulator	Machinery gene

Sequence

Protein

• Length: 98 a.a.
• Molecular weight: 10758.43 Da
• Isoelectric Point: 4.8898

>NTDB_id=517103 I6H74_RS05145 WP_027971722.1 1036434..1036730(+) (HI0659) [Streptococcus dysgalactiae strain FDAARGOS_1017]
MKNNAIGSNWKDVRAELFSKEEILESDMRVAIMSELIEARNEKGISQKKLEEMSGVSQPVIARMETGKTSPQLDTVLKVL
ASLGKTLAVVPIEGEQVS

Nucleotide

• Length: 297 bp

>NTDB_id=517103 I6H74_RS05145 WP_027971722.1 1036434..1036730(+) (HI0659) [Streptococcus dysgalactiae strain FDAARGOS_1017]
ATGAAAAATAATGCTATTGGTAGTAACTGGAAAGATGTAAGAGCTGAATTATTCAGCAAAGAAGAAATTTTGGAAAGTGA
TATGCGCGTGGCTATCATGAGCGAGCTTATCGAGGCTAGAAATGAAAAGGGCATTAGCCAGAAGAAACTAGAGGAGATGA
GTGGTGTTAGTCAACCTGTTATCGCTAGGATGGAAACAGGAAAGACAAGCCCACAGCTTGATACAGTGCTAAAAGTATTG
GCTAGTTTGGGTAAGACTTTAGCTGTTGTACCCATAGAGGGCGAACAGGTAAGCTAG

Domains

Predicted by InterproScan.

• Helix-turn-helix (HTH_3) (37-88)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
HI0659	Haemophilus influenzae Rd KW20	56.044	92.857	0.52