Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   JAV55_RS17890 Genome accession   NZ_CP065943
Coordinates   3453600..3453884 (-) Length   94 a.a.
NCBI ID   WP_003185421.1    Uniprot ID   A0A1Y0XQV9
Organism   Bacillus licheniformis strain H2     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3405345..3458755 3453600..3453884 within 0


Gene organization within MGE regions


Location: 3405345..3458755
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JAV55_RS17565 (JAV55_17565) - 3405345..3405563 (-) 219 WP_026699399.1 transcriptional regulator -
  JAV55_RS17570 (JAV55_17570) - 3405790..3406359 (+) 570 WP_011198295.1 hypothetical protein -
  JAV55_RS17575 (JAV55_17575) - 3406605..3406697 (-) 93 Protein_3449 peptidoglycan-binding protein -
  JAV55_RS17580 (JAV55_17580) - 3406896..3407312 (-) 417 WP_021837698.1 protein-export chaperone SecB -
  JAV55_RS17585 (JAV55_17585) - 3407309..3407629 (-) 321 WP_021837699.1 hypothetical protein -
  JAV55_RS17590 (JAV55_17590) - 3407666..3408241 (-) 576 WP_021837700.1 hypothetical protein -
  JAV55_RS17595 (JAV55_17595) - 3408475..3408705 (-) 231 WP_021837701.1 helix-turn-helix domain-containing protein -
  JAV55_RS17600 (JAV55_17600) - 3408960..3409103 (-) 144 WP_021837703.1 hypothetical protein -
  JAV55_RS21780 - 3409304..3411025 (+) 1722 WP_021837704.1 T7SS effector LXG polymorphic toxin -
  JAV55_RS17615 (JAV55_17615) - 3411043..3411387 (+) 345 WP_021837705.1 hypothetical protein -
  JAV55_RS17620 (JAV55_17620) - 3411461..3412303 (-) 843 WP_021837706.1 N-acetylmuramoyl-L-alanine amidase -
  JAV55_RS17625 (JAV55_17625) - 3412355..3412618 (-) 264 WP_011198302.1 phage holin -
  JAV55_RS17630 (JAV55_17630) - 3412634..3412903 (-) 270 WP_009329192.1 hemolysin XhlA family protein -
  JAV55_RS17635 (JAV55_17635) - 3412966..3413151 (-) 186 WP_003185324.1 XkdX family protein -
  JAV55_RS17640 (JAV55_17640) - 3413148..3413471 (-) 324 WP_003185326.1 bZIP transcription factor -
  JAV55_RS17645 (JAV55_17645) - 3413484..3414821 (-) 1338 WP_021837707.1 phage baseplate upper protein -
  JAV55_RS17650 (JAV55_17650) - 3414842..3416797 (-) 1956 WP_021837708.1 right-handed parallel beta-helix repeat-containing protein -
  JAV55_RS17655 (JAV55_17655) - 3416833..3418545 (-) 1713 WP_003185331.1 phage tail protein -
  JAV55_RS17660 (JAV55_17660) - 3418558..3419394 (-) 837 WP_003185333.1 phage tail family protein -
  JAV55_RS17665 (JAV55_17665) - 3419391..3423866 (-) 4476 WP_021837710.1 phage tail tape measure protein -
  JAV55_RS17670 (JAV55_17670) gpG 3424075..3424437 (-) 363 WP_003185339.1 phage tail assembly chaperone G -
  JAV55_RS17675 (JAV55_17675) - 3424491..3425108 (-) 618 WP_003185341.1 major tail protein -
  JAV55_RS17680 (JAV55_17680) - 3425123..3425506 (-) 384 WP_021837711.1 DUF3168 domain-containing protein -
  JAV55_RS17685 (JAV55_17685) - 3425503..3425901 (-) 399 WP_003185346.1 HK97-gp10 family putative phage morphogenesis protein -
  JAV55_RS17690 (JAV55_17690) - 3425901..3426209 (-) 309 WP_003185349.1 phage head closure protein -
  JAV55_RS17695 (JAV55_17695) - 3426199..3426501 (-) 303 WP_021837712.1 head-tail connector protein -
  JAV55_RS17700 (JAV55_17700) - 3426522..3426949 (-) 428 Protein_3473 collagen-like protein -
  JAV55_RS17705 (JAV55_17705) - 3426973..3428256 (-) 1284 WP_021837713.1 phage major capsid protein -
  JAV55_RS17710 (JAV55_17710) - 3428294..3429025 (-) 732 WP_021837714.1 head maturation protease, ClpP-related -
  JAV55_RS17715 (JAV55_17715) - 3428970..3430280 (-) 1311 WP_021837715.1 phage portal protein -
  JAV55_RS17720 (JAV55_17720) - 3430281..3430472 (-) 192 WP_021837716.1 DUF1056 family protein -
  JAV55_RS17725 (JAV55_17725) - 3430484..3432193 (-) 1710 WP_003185362.1 terminase large subunit -
  JAV55_RS17730 (JAV55_17730) - 3432190..3432705 (-) 516 WP_003185364.1 phage terminase small subunit P27 family -
  JAV55_RS17735 (JAV55_17735) - 3432935..3433309 (-) 375 WP_021837717.1 HNH endonuclease -
  JAV55_RS17740 (JAV55_17740) - 3433637..3434197 (-) 561 WP_021837719.1 hypothetical protein -
  JAV55_RS17745 (JAV55_17745) - 3434395..3434622 (-) 228 WP_006637236.1 hypothetical protein -
  JAV55_RS17750 (JAV55_17750) cotD 3434839..3435063 (-) 225 WP_006637235.1 spore coat protein CotD -
  JAV55_RS17755 (JAV55_17755) - 3435814..3436194 (-) 381 WP_021837721.1 ArpU family phage packaging/lysis transcriptional regulator -
  JAV55_RS17760 (JAV55_17760) - 3436307..3436684 (-) 378 WP_021837723.1 YopX family protein -
  JAV55_RS17765 (JAV55_17765) - 3436700..3437215 (-) 516 WP_021837724.1 putative metallopeptidase -
  JAV55_RS17770 (JAV55_17770) fbpA 3437218..3437388 (-) 171 WP_021837725.1 Fur-regulated basic protein FbpA -
  JAV55_RS17775 (JAV55_17775) - 3437385..3437924 (-) 540 WP_021837726.1 ERCC4 domain-containing protein -
  JAV55_RS17780 (JAV55_17780) - 3437921..3438358 (-) 438 WP_021837727.1 hypothetical protein -
  JAV55_RS17785 (JAV55_17785) - 3438336..3438707 (-) 372 WP_021837728.1 hypothetical protein -
  JAV55_RS17790 (JAV55_17790) - 3438928..3441360 (-) 2433 WP_021837729.1 phage/plasmid primase, P4 family -
  JAV55_RS17795 (JAV55_17795) - 3441421..3441858 (-) 438 WP_009329263.1 DUF669 domain-containing protein -
  JAV55_RS17800 (JAV55_17800) - 3441858..3442790 (-) 933 WP_011198320.1 AAA family ATPase -
  JAV55_RS17805 (JAV55_17805) - 3442794..3443351 (-) 558 WP_021837730.1 host-nuclease inhibitor Gam family protein -
  JAV55_RS17810 (JAV55_17810) - 3443444..3443686 (-) 243 WP_011198322.1 hypothetical protein -
  JAV55_RS17815 (JAV55_17815) - 3443774..3444040 (-) 267 WP_021837731.1 YqaH family protein -
  JAV55_RS17820 (JAV55_17820) - 3444103..3444432 (+) 330 WP_021837732.1 hypothetical protein -
  JAV55_RS17825 (JAV55_17825) - 3444429..3444587 (-) 159 WP_021837733.1 hypothetical protein -
  JAV55_RS17830 (JAV55_17830) - 3444713..3445267 (-) 555 WP_003185401.1 hypothetical protein -
  JAV55_RS17835 (JAV55_17835) - 3445325..3445513 (-) 189 WP_016886536.1 hypothetical protein -
  JAV55_RS17840 (JAV55_17840) - 3445645..3445833 (-) 189 WP_003185403.1 helix-turn-helix transcriptional regulator -
  JAV55_RS17845 (JAV55_17845) - 3445830..3446624 (-) 795 WP_198479860.1 ORF6N domain-containing protein -
  JAV55_RS17850 (JAV55_17850) - 3446648..3446866 (-) 219 WP_021837734.1 helix-turn-helix transcriptional regulator -
  JAV55_RS17855 (JAV55_17855) - 3447043..3447681 (+) 639 WP_003185408.1 LexA family transcriptional regulator -
  JAV55_RS17860 (JAV55_17860) - 3447752..3448846 (+) 1095 WP_021837735.1 site-specific integrase -
  JAV55_RS17870 (JAV55_17870) smpB 3449410..3449883 (-) 474 WP_009329604.1 SsrA-binding protein SmpB -
  JAV55_RS17875 (JAV55_17875) rnr 3449995..3452298 (-) 2304 WP_003185414.1 ribonuclease R -
  JAV55_RS17880 (JAV55_17880) - 3452312..3453058 (-) 747 WP_003185416.1 carboxylesterase -
  JAV55_RS17885 (JAV55_17885) secG 3453199..3453429 (-) 231 WP_003185418.1 preprotein translocase subunit SecG -
  JAV55_RS17890 (JAV55_17890) abrB 3453600..3453884 (-) 285 WP_003185421.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  JAV55_RS17895 (JAV55_17895) - 3453913..3454146 (-) 234 WP_085959538.1 helix-turn-helix transcriptional regulator -
  JAV55_RS17900 (JAV55_17900) - 3454299..3454700 (+) 402 WP_009329609.1 transcriptional regulator -
  JAV55_RS17905 (JAV55_17905) - 3454870..3455268 (+) 399 WP_009329610.1 helix-turn-helix domain-containing protein -
  JAV55_RS17910 (JAV55_17910) - 3455316..3455993 (-) 678 WP_003185432.1 ABC transporter permease -
  JAV55_RS17915 (JAV55_17915) opuCC 3456010..3456927 (-) 918 WP_009329611.1 osmoprotectant ABC transporter substrate-binding lipoprotein OpuCC -
  JAV55_RS17920 (JAV55_17920) - 3456941..3457594 (-) 654 WP_009329612.1 ABC transporter permease -
  JAV55_RS17925 (JAV55_17925) - 3457616..3458755 (-) 1140 WP_198479861.1 betaine/proline/choline family ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 94 a.a.        Molecular weight: 10486.36 Da        Isoelectric Point: 7.9620

>NTDB_id=515561 JAV55_RS17890 WP_003185421.1 3453600..3453884(-) (abrB) [Bacillus licheniformis strain H2]
MKNTGIVRRIDELGRVVLPVEMRRVLNINEKDPLEIYTDGENIILTKYAANMACLMTGDITTKNKTYAGGKIVLSPRGAE
MLLEDMMAALSEKK

Nucleotide


Download         Length: 285 bp        

>NTDB_id=515561 JAV55_RS17890 WP_003185421.1 3453600..3453884(-) (abrB) [Bacillus licheniformis strain H2]
GTGAAAAATACCGGGATTGTCCGGAGAATCGATGAGCTCGGCAGAGTCGTTCTCCCGGTCGAAATGCGCAGGGTGCTGAA
TATCAATGAAAAGGACCCGCTCGAAATATATACCGACGGCGAAAACATCATTTTGACAAAATACGCCGCAAACATGGCAT
GTTTGATGACCGGCGACATCACCACGAAAAATAAAACGTATGCGGGCGGCAAAATCGTACTCAGCCCGCGCGGAGCGGAA
ATGCTCCTGGAAGATATGATGGCGGCACTGTCAGAAAAGAAATAA

Domains

Predicted by InterproScan.

AbrB C-terminal domain (AbrB_C)

(53-85)

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(9-50)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A1Y0XQV9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

56.044

96.809

0.543