Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | I8N72_RS14850 | Genome accession | NZ_CP065790 |
| Coordinates | 3028050..3028190 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain LBUM1082 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3023050..3033190
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I8N72_RS14825 (I8N72_14825) | - | 3023390..3023773 (-) | 384 | WP_003152054.1 | hotdog fold thioesterase | - |
| I8N72_RS14830 (I8N72_14830) | comA | 3023795..3024439 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| I8N72_RS14835 (I8N72_14835) | comP | 3024520..3026811 (-) | 2292 | WP_015387784.1 | histidine kinase | Regulator |
| I8N72_RS14840 (I8N72_14840) | comX | 3026823..3026987 (-) | 165 | WP_007613432.1 | competence pheromone ComX | - |
| I8N72_RS14845 (I8N72_14845) | - | 3026987..3027898 (-) | 912 | WP_014305720.1 | polyprenyl synthetase family protein | - |
| I8N72_RS14850 (I8N72_14850) | degQ | 3028050..3028190 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| I8N72_RS14855 (I8N72_14855) | - | 3028656..3028997 (+) | 342 | WP_014305721.1 | hypothetical protein | - |
| I8N72_RS14860 (I8N72_14860) | - | 3029004..3030224 (-) | 1221 | WP_015387782.1 | EAL and HDOD domain-containing protein | - |
| I8N72_RS14865 (I8N72_14865) | - | 3030354..3031820 (-) | 1467 | WP_014305722.1 | nicotinate phosphoribosyltransferase | - |
| I8N72_RS14870 (I8N72_14870) | - | 3031838..3032389 (-) | 552 | WP_003152033.1 | cysteine hydrolase family protein | - |
| I8N72_RS14875 (I8N72_14875) | - | 3032486..3032884 (-) | 399 | WP_003152031.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=514497 I8N72_RS14850 WP_003152043.1 3028050..3028190(-) (degQ) [Bacillus velezensis strain LBUM1082]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=514497 I8N72_RS14850 WP_003152043.1 3028050..3028190(-) (degQ) [Bacillus velezensis strain LBUM1082]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |