Detailed information    

insolico Bioinformatically predicted

Overview

Name   nucA/comI   Type   Machinery gene
Locus tag   I8N71_RS13905 Genome accession   NZ_CP065789
Coordinates   2651988..2652398 (-) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus subtilis strain LBUM979     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2647354..2698844 2651988..2652398 within 0


Gene organization within MGE regions


Location: 2647354..2698844
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I8N71_RS13880 (I8N71_13880) yqeF 2647521..2648252 (-) 732 WP_003229964.1 SGNH/GDSL hydrolase family protein -
  I8N71_RS13885 (I8N71_13885) cwlH 2648504..2649256 (-) 753 WP_003229963.1 N-acetylmuramoyl-L-alanine amidase CwlH -
  I8N71_RS13890 (I8N71_13890) yqeD 2649443..2650069 (+) 627 WP_003229962.1 TVP38/TMEM64 family protein -
  I8N71_RS13895 (I8N71_13895) gnd 2650088..2650981 (-) 894 WP_003229961.1 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  I8N71_RS13900 (I8N71_13900) yqeB 2651233..2651955 (+) 723 WP_010886572.1 hypothetical protein -
  I8N71_RS13905 (I8N71_13905) nucA/comI 2651988..2652398 (-) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  I8N71_RS13910 (I8N71_13910) - 2652594..2652941 (+) 348 Protein_2703 sigma-70 family RNA polymerase sigma factor -
  I8N71_RS13915 (I8N71_13915) spoIVCA 2652972..2654432 (-) 1461 WP_223257626.1 site-specific DNA recombinase SpoIVCA -
  I8N71_RS22160 - 2654390..2654568 (-) 179 Protein_2705 hypothetical protein -
  I8N71_RS13920 (I8N71_13920) arsC 2654923..2655342 (-) 420 WP_004398596.1 thioredoxin-dependent arsenate reductase -
  I8N71_RS13925 (I8N71_13925) acr3 2655354..2656394 (-) 1041 WP_004398718.1 arsenite efflux transporter Acr3 -
  I8N71_RS13930 (I8N71_13930) arsK 2656417..2656857 (-) 441 WP_003229954.1 ArsI/CadI family heavy metal resistance metalloenzyme -
  I8N71_RS13935 (I8N71_13935) arsR 2656918..2657235 (-) 318 WP_004399122.1 arsenical resistance operon transcriptional regulator ArsR -
  I8N71_RS13940 (I8N71_13940) yqcI 2657607..2658371 (-) 765 WP_004398670.1 YqcI/YcgG family protein -
  I8N71_RS13945 (I8N71_13945) rapE 2658814..2659941 (+) 1128 WP_004398842.1 response regulator aspartate phosphatase RapE -
  I8N71_RS13950 (I8N71_13950) phrE 2659931..2660065 (+) 135 WP_004398770.1 phosphatase RapE inhibitor PhrE -
  I8N71_RS13955 (I8N71_13955) - 2660175..2660333 (+) 159 WP_003245945.1 hypothetical protein -
  I8N71_RS13960 (I8N71_13960) yqcG 2660703..2662298 (+) 1596 WP_004399034.1 LXG family T7SS effector endonuclease toxin YqcG -
  I8N71_RS13965 (I8N71_13965) yqcF 2662313..2662891 (+) 579 WP_009967790.1 type VII secretion system immunity protein YqcF -
  I8N71_RS13970 (I8N71_13970) - 2663009..2663155 (+) 147 WP_009967791.1 hypothetical protein -
  I8N71_RS13975 (I8N71_13975) - 2663152..2663514 (-) 363 WP_003229947.1 hypothetical protein -
  I8N71_RS13980 (I8N71_13980) - 2663530..2664009 (-) 480 WP_004399085.1 hypothetical protein -
  I8N71_RS13985 (I8N71_13985) cwlA 2664174..2664992 (-) 819 WP_003229946.1 N-acetylmuramoyl-L-alanine amidase CwlA -
  I8N71_RS13990 (I8N71_13990) skhD 2665037..2665459 (-) 423 WP_003246208.1 holin family protein -
  I8N71_RS13995 (I8N71_13995) xepAK 2665504..2666397 (-) 894 WP_003246010.1 hypothetical protein -
  I8N71_RS14000 (I8N71_14000) yqcE 2666485..2666649 (-) 165 WP_003229944.1 XkdX family protein -
  I8N71_RS14005 (I8N71_14005) yqcD 2666646..2666981 (-) 336 WP_009967793.1 XkdW family protein -
  I8N71_RS14010 (I8N71_14010) yqcC 2666991..2668091 (-) 1101 WP_003229943.1 pyocin knob domain-containing protein -
  I8N71_RS14015 (I8N71_14015) - 2668094..2668366 (-) 273 WP_003229942.1 hypothetical protein -
  I8N71_RS14020 (I8N71_14020) yqcA 2668363..2668941 (-) 579 WP_003229941.1 YmfQ family protein -
  I8N71_RS14025 (I8N71_14025) yqbT 2668925..2669971 (-) 1047 WP_003229940.1 baseplate J/gp47 family protein -
  I8N71_RS14030 (I8N71_14030) yqbS 2669964..2670389 (-) 426 WP_004398572.1 DUF2634 domain-containing protein -
  I8N71_RS14035 (I8N71_14035) yqbR 2670402..2670665 (-) 264 WP_003229938.1 DUF2577 family protein -
  I8N71_RS14040 (I8N71_14040) yqbQ 2670662..2671642 (-) 981 WP_004398524.1 hypothetical protein -
  I8N71_RS14045 (I8N71_14045) yqbP 2671655..2672314 (-) 660 WP_004398548.1 LysM peptidoglycan-binding domain-containing protein -
  I8N71_RS14050 (I8N71_14050) yqbO 2672307..2677064 (-) 4758 WP_003246092.1 phage tail tape measure protein -
  I8N71_RS14055 (I8N71_14055) - 2677067..2677204 (-) 138 WP_003229934.1 hypothetical protein -
  I8N71_RS14060 (I8N71_14060) - 2677246..2677695 (-) 450 WP_003229933.1 phage portal protein -
  I8N71_RS14065 (I8N71_14065) txpA 2677841..2678020 (+) 180 WP_004398662.1 type I toxin-antitoxin system toxin TxpA -
  I8N71_RS14070 (I8N71_14070) bsrH 2678400..2678489 (+) 90 WP_075058862.1 type I toxin-antitoxin system toxin BsrH -
  I8N71_RS14075 (I8N71_14075) yqbM 2678743..2679186 (-) 444 WP_003229930.1 phage tail tube protein -
  I8N71_RS14080 (I8N71_14080) yqbK 2679189..2680589 (-) 1401 WP_003229929.1 phage tail sheath family protein -
  I8N71_RS14085 (I8N71_14085) - 2680590..2680781 (-) 192 WP_010886574.1 hypothetical protein -
  I8N71_RS14090 (I8N71_14090) yqbJ 2680778..2681215 (-) 438 WP_003229927.1 DUF6838 family protein -
  I8N71_RS14095 (I8N71_14095) yqbI 2681228..2681731 (-) 504 WP_003246050.1 HK97 gp10 family phage protein -
  I8N71_RS14100 (I8N71_14100) yqbH 2681728..2682090 (-) 363 WP_003229925.1 YqbH/XkdH family protein -
  I8N71_RS14105 (I8N71_14105) gkpG 2682087..2682482 (-) 396 WP_004398566.1 DUF3199 family protein -
  I8N71_RS14110 (I8N71_14110) yqbF 2682486..2682797 (-) 312 WP_003229923.1 YqbF domain-containing protein -
  I8N71_RS14115 (I8N71_14115) skdG 2682808..2683743 (-) 936 WP_003229922.1 phage major capsid protein -
  I8N71_RS14120 (I8N71_14120) yqbD 2683762..2684730 (-) 969 WP_003229921.1 XkdF-like putative serine protease domain-containing protein -
  I8N71_RS14125 (I8N71_14125) - 2684763..2685416 (-) 654 WP_003229920.1 hypothetical protein -
  I8N71_RS14130 (I8N71_14130) yqbB 2685457..2686374 (-) 918 WP_004398748.1 phage head morphogenesis protein -
  I8N71_RS14135 (I8N71_14135) yqbA 2686371..2687903 (-) 1533 WP_004398894.1 phage portal protein -
  I8N71_RS14140 (I8N71_14140) stmB 2687907..2689202 (-) 1296 WP_003229917.1 PBSX family phage terminase large subunit -
  I8N71_RS14145 (I8N71_14145) terS 2689195..2689914 (-) 720 WP_003229916.1 phage terminase small subunit -
  I8N71_RS14150 (I8N71_14150) - 2689982..2690446 (-) 465 WP_004398685.1 hypothetical protein -
  I8N71_RS14155 (I8N71_14155) yqaQ 2690590..2691045 (-) 456 WP_004398775.1 hypothetical protein -
  I8N71_RS14160 (I8N71_14160) - 2691243..2692172 (+) 930 WP_003229913.1 hypothetical protein -
  I8N71_RS14165 (I8N71_14165) yqaO 2692246..2692452 (-) 207 WP_003229912.1 XtrA/YqaO family protein -
  I8N71_RS14170 (I8N71_14170) yqaN 2692534..2692962 (-) 429 WP_009967809.1 RusA family crossover junction endodeoxyribonuclease -
  I8N71_RS14175 (I8N71_14175) - 2693058..2693207 (-) 150 WP_003229910.1 hypothetical protein -
  I8N71_RS14180 (I8N71_14180) sknM 2693198..2694139 (-) 942 WP_075058863.1 ATP-binding protein -
  I8N71_RS14185 (I8N71_14185) yqaL 2694021..2694698 (-) 678 WP_010886575.1 DnaD domain protein -
  I8N71_RS14190 (I8N71_14190) recT 2694774..2695628 (-) 855 WP_003229907.1 recombinase RecT -
  I8N71_RS14195 (I8N71_14195) yqaJ 2695631..2696590 (-) 960 WP_004398673.1 YqaJ viral recombinase family protein -
  I8N71_RS14200 (I8N71_14200) - 2696696..2696890 (-) 195 WP_003229905.1 hypothetical protein -
  I8N71_RS14205 (I8N71_14205) - 2696850..2697023 (-) 174 WP_119123069.1 hypothetical protein -
  I8N71_RS14210 (I8N71_14210) sknH 2697020..2697277 (-) 258 WP_003245994.1 YqaH family protein -
  I8N71_RS14215 (I8N71_14215) yqaG 2697274..2697843 (-) 570 WP_004398626.1 helix-turn-helix transcriptional regulator -
  I8N71_RS14220 (I8N71_14220) - 2697917..2698057 (-) 141 WP_003229902.1 hypothetical protein -
  I8N71_RS14225 (I8N71_14225) yqaF 2698087..2698317 (-) 231 WP_004398958.1 helix-turn-helix transcriptional regulator -
  I8N71_RS14230 (I8N71_14230) sknR 2698494..2698844 (+) 351 WP_004398704.1 transcriptional regulator SknR -

Sequence

Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=514408 I8N71_RS13905 WP_009967785.1 2651988..2652398(-) (nucA/comI) [Bacillus subtilis strain LBUM979]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=514408 I8N71_RS13905 WP_009967785.1 2651988..2652398(-) (nucA/comI) [Bacillus subtilis strain LBUM979]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG

Domains

Predicted by InterproScan.

Deoxyribonuclease NucA/NucB (DNase_NucA_NucB)

(40-130)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529