Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | MUS_RS16115 | Genome accession | NC_017912 |
| Coordinates | 3276376..3276516 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis YAU B9601-Y2 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3271376..3281516
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MUS_RS16090 (MUS_3460) | - | 3271690..3272073 (-) | 384 | WP_014418761.1 | hotdog fold thioesterase | - |
| MUS_RS16095 (MUS_3461) | comA | 3272095..3272739 (-) | 645 | WP_014418762.1 | response regulator transcription factor | Regulator |
| MUS_RS16100 | comP | 3272820..3275126 (-) | 2307 | WP_041481798.1 | histidine kinase | Regulator |
| MUS_RS16105 | comX | 3275149..3275319 (-) | 171 | WP_032863917.1 | competence pheromone ComX | - |
| MUS_RS16110 (MUS_3463) | - | 3275319..3276245 (-) | 927 | WP_014721741.1 | polyprenyl synthetase family protein | - |
| MUS_RS16115 (MUS_3464) | degQ | 3276376..3276516 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| MUS_RS16120 (MUS_3465) | - | 3276982..3277323 (+) | 342 | WP_014418765.1 | hypothetical protein | - |
| MUS_RS16125 (MUS_3467) | - | 3277330..3278553 (-) | 1224 | WP_014418766.1 | EAL and HDOD domain-containing protein | - |
| MUS_RS16130 (MUS_3468) | - | 3278683..3280149 (-) | 1467 | WP_014418767.1 | nicotinate phosphoribosyltransferase | - |
| MUS_RS16135 (MUS_3469) | - | 3280167..3280718 (-) | 552 | WP_003152033.1 | isochorismatase family cysteine hydrolase | - |
| MUS_RS16140 (MUS_3470) | - | 3280815..3281213 (-) | 399 | WP_003152031.1 | DUF1694 domain-containing protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=51267 MUS_RS16115 WP_003152043.1 3276376..3276516(-) (degQ) [Bacillus velezensis YAU B9601-Y2]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=51267 MUS_RS16115 WP_003152043.1 3276376..3276516(-) (degQ) [Bacillus velezensis YAU B9601-Y2]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |