Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MUS_RS16115 Genome accession   NC_017912
Coordinates   3276376..3276516 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis YAU B9601-Y2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3271376..3281516
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MUS_RS16090 (MUS_3460) - 3271690..3272073 (-) 384 WP_014418761.1 hotdog fold thioesterase -
  MUS_RS16095 (MUS_3461) comA 3272095..3272739 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  MUS_RS16100 comP 3272820..3275126 (-) 2307 WP_041481798.1 histidine kinase Regulator
  MUS_RS16105 comX 3275149..3275319 (-) 171 WP_032863917.1 competence pheromone ComX -
  MUS_RS16110 (MUS_3463) - 3275319..3276245 (-) 927 WP_014721741.1 polyprenyl synthetase family protein -
  MUS_RS16115 (MUS_3464) degQ 3276376..3276516 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  MUS_RS16120 (MUS_3465) - 3276982..3277323 (+) 342 WP_014418765.1 hypothetical protein -
  MUS_RS16125 (MUS_3467) - 3277330..3278553 (-) 1224 WP_014418766.1 EAL and HDOD domain-containing protein -
  MUS_RS16130 (MUS_3468) - 3278683..3280149 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  MUS_RS16135 (MUS_3469) - 3280167..3280718 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  MUS_RS16140 (MUS_3470) - 3280815..3281213 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=51267 MUS_RS16115 WP_003152043.1 3276376..3276516(-) (degQ) [Bacillus velezensis YAU B9601-Y2]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=51267 MUS_RS16115 WP_003152043.1 3276376..3276516(-) (degQ) [Bacillus velezensis YAU B9601-Y2]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment