Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   I6G80_RS12580 Genome accession   NZ_CP065647
Coordinates   2352175..2352351 (-) Length   58 a.a.
NCBI ID   WP_003183444.1    Uniprot ID   -
Organism   Bacillus licheniformis strain FDAARGOS_923     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2347175..2357351
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I6G80_RS12535 (I6G80_12535) comGE 2347510..2347857 (+) 348 WP_009327907.1 competence type IV pilus minor pilin ComGE -
  I6G80_RS12540 (I6G80_12540) comGF 2347883..2348254 (+) 372 WP_003183461.1 competence type IV pilus minor pilin ComGF -
  I6G80_RS12545 (I6G80_12545) comGG 2348267..2348632 (+) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  I6G80_RS12550 (I6G80_12550) - 2348721..2348903 (+) 183 WP_003183456.1 YqzE family protein -
  I6G80_RS12555 (I6G80_12555) - 2348927..2349247 (-) 321 WP_003183454.1 YqzG/YhdC family protein -
  I6G80_RS12560 (I6G80_12560) tapA 2349524..2350252 (+) 729 WP_003183451.1 amyloid fiber anchoring/assembly protein TapA -
  I6G80_RS12565 (I6G80_12565) sipW 2350249..2350833 (+) 585 WP_003183449.1 signal peptidase I SipW -
  I6G80_RS12570 (I6G80_12570) tasA 2350907..2351701 (+) 795 WP_003183447.1 biofilm matrix protein TasA -
  I6G80_RS12575 (I6G80_12575) sinR 2351806..2352141 (-) 336 WP_025804940.1 transcriptional regulator SinR Regulator
  I6G80_RS12580 (I6G80_12580) sinI 2352175..2352351 (-) 177 WP_003183444.1 anti-repressor SinI Regulator
  I6G80_RS12585 (I6G80_12585) - 2352542..2353336 (-) 795 WP_061578400.1 YqhG family protein -
  I6G80_RS12590 (I6G80_12590) - 2353343..2355022 (-) 1680 WP_003183439.1 DEAD/DEAH box helicase -
  I6G80_RS12595 (I6G80_12595) gcvT 2355615..2356709 (+) 1095 WP_003183436.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6724.47 Da        Isoelectric Point: 4.7616

>NTDB_id=512540 I6G80_RS12580 WP_003183444.1 2352175..2352351(-) (sinI) [Bacillus licheniformis strain FDAARGOS_923]
MNKDKNEKEELDEEWTDLIKHALEQGISPEEIRIFLNLGKKSSNPSTSIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=512540 I6G80_RS12580 WP_003183444.1 2352175..2352351(-) (sinI) [Bacillus licheniformis strain FDAARGOS_923]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGACTTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGAAATACGTATTTTTCTCAATTTGGGAAAGAAGTCTTCAAATCCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

51.724

100

0.517