Detailed information    

insolico Bioinformatically predicted

Overview


Name   abrB   Type   Regulator
Locus tag   I6G80_RS06955 Genome accession   NZ_CP065647
Coordinates   1320813..1321097 (+) Length   94 a.a.
NCBI ID   WP_003185421.1    Uniprot ID   A0A1Y0XQV9
Organism   Bacillus licheniformis strain FDAARGOS_923     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1315942..1368248 1320813..1321097 within 0


Gene organization within MGE regions


Location: 1315942..1368248
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I6G80_RS06920 (I6G80_06920) - 1315942..1317081 (+) 1140 WP_003185439.1 betaine/proline/choline family ABC transporter ATP-binding protein -
  I6G80_RS06925 (I6G80_06925) - 1317103..1317756 (+) 654 WP_009329612.1 ABC transporter permease -
  I6G80_RS06930 (I6G80_06930) opuCC 1317770..1318687 (+) 918 WP_009329611.1 osmoprotectant ABC transporter substrate-binding lipoprotein OpuCC -
  I6G80_RS06935 (I6G80_06935) - 1318704..1319381 (+) 678 WP_003185432.1 ABC transporter permease -
  I6G80_RS06940 (I6G80_06940) - 1319429..1319827 (-) 399 WP_009329610.1 helix-turn-helix domain-containing protein -
  I6G80_RS06945 (I6G80_06945) - 1319997..1320398 (-) 402 WP_026080846.1 transcriptional regulator -
  I6G80_RS06950 (I6G80_06950) - 1320551..1320784 (+) 234 WP_085959538.1 helix-turn-helix domain-containing protein -
  I6G80_RS06955 (I6G80_06955) abrB 1320813..1321097 (+) 285 WP_003185421.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  I6G80_RS06960 (I6G80_06960) secG 1321268..1321498 (+) 231 WP_003185418.1 preprotein translocase subunit SecG -
  I6G80_RS06965 (I6G80_06965) - 1321639..1322385 (+) 747 WP_003185416.1 alpha/beta hydrolase -
  I6G80_RS06970 (I6G80_06970) rnr 1322399..1324702 (+) 2304 WP_003185414.1 ribonuclease R -
  I6G80_RS06975 (I6G80_06975) smpB 1324814..1325287 (+) 474 WP_009329604.1 SsrA-binding protein SmpB -
  I6G80_RS06985 (I6G80_06985) - 1325839..1326933 (-) 1095 WP_017474703.1 tyrosine-type recombinase/integrase -
  I6G80_RS06990 (I6G80_06990) - 1327004..1327642 (-) 639 WP_069500786.1 LexA family protein -
  I6G80_RS06995 (I6G80_06995) - 1327819..1328037 (+) 219 WP_003185407.1 helix-turn-helix domain-containing protein -
  I6G80_RS07000 (I6G80_07000) - 1328061..1328855 (+) 795 WP_011198327.1 ORF6N domain-containing protein -
  I6G80_RS07005 (I6G80_07005) - 1328852..1329040 (+) 189 WP_003185403.1 helix-turn-helix transcriptional regulator -
  I6G80_RS07010 (I6G80_07010) - 1329172..1329360 (+) 189 WP_016886536.1 hypothetical protein -
  I6G80_RS07015 (I6G80_07015) - 1329419..1329973 (+) 555 WP_003185401.1 hypothetical protein -
  I6G80_RS07020 (I6G80_07020) - 1330125..1330289 (+) 165 WP_017474700.1 hypothetical protein -
  I6G80_RS07025 (I6G80_07025) - 1330322..1330492 (+) 171 WP_011198326.1 hypothetical protein -
  I6G80_RS07030 (I6G80_07030) - 1330484..1330864 (-) 381 WP_011198325.1 DUF2513 domain-containing protein -
  I6G80_RS07035 (I6G80_07035) - 1330924..1331190 (+) 267 WP_011198324.1 YqaH family protein -
  I6G80_RS07040 (I6G80_07040) - 1331278..1331520 (+) 243 WP_011198322.1 hypothetical protein -
  I6G80_RS07045 (I6G80_07045) - 1331613..1332170 (+) 558 WP_025807637.1 host-nuclease inhibitor Gam family protein -
  I6G80_RS07050 (I6G80_07050) - 1332174..1333109 (+) 936 WP_025807635.1 AAA family ATPase -
  I6G80_RS07055 (I6G80_07055) - 1333099..1333452 (+) 354 WP_017474382.1 hypothetical protein -
  I6G80_RS07060 (I6G80_07060) - 1333471..1333911 (+) 441 WP_061578359.1 DUF669 domain-containing protein -
  I6G80_RS07065 (I6G80_07065) - 1333972..1336404 (+) 2433 WP_025807632.1 phage/plasmid primase, P4 family -
  I6G80_RS07070 (I6G80_07070) - 1336680..1336943 (+) 264 WP_025807631.1 hypothetical protein -
  I6G80_RS07075 (I6G80_07075) - 1336921..1337358 (+) 438 WP_025807629.1 hypothetical protein -
  I6G80_RS07080 (I6G80_07080) - 1337355..1337894 (+) 540 WP_025807627.1 ERCC4 domain-containing protein -
  I6G80_RS07085 (I6G80_07085) - 1337891..1338061 (+) 171 WP_071583658.1 Fur-regulated basic protein FbpA -
  I6G80_RS07090 (I6G80_07090) - 1338064..1338579 (+) 516 WP_025807625.1 putative metallopeptidase -
  I6G80_RS07095 (I6G80_07095) - 1338595..1338972 (+) 378 WP_025807623.1 YopX family protein -
  I6G80_RS07100 (I6G80_07100) - 1339085..1339465 (+) 381 WP_009329244.1 ArpU family phage packaging/lysis transcriptional regulator -
  I6G80_RS07105 (I6G80_07105) - 1340399..1341121 (+) 723 WP_077735605.1 hypothetical protein -
  I6G80_RS07110 (I6G80_07110) - 1341181..1341408 (+) 228 WP_061578527.1 hypothetical protein -
  I6G80_RS07115 (I6G80_07115) - 1341606..1342166 (+) 561 WP_077735604.1 hypothetical protein -
  I6G80_RS07120 (I6G80_07120) - 1342153..1342467 (+) 315 WP_025807615.1 hypothetical protein -
  I6G80_RS07125 (I6G80_07125) - 1342494..1342868 (+) 375 WP_025807614.1 HNH endonuclease -
  I6G80_RS07130 (I6G80_07130) - 1343099..1343614 (+) 516 WP_025807612.1 phage terminase small subunit P27 family -
  I6G80_RS07135 (I6G80_07135) - 1343611..1345320 (+) 1710 WP_025807610.1 terminase large subunit -
  I6G80_RS07140 (I6G80_07140) - 1345332..1345523 (+) 192 WP_025807608.1 DUF1056 family protein -
  I6G80_RS07145 (I6G80_07145) - 1345524..1346834 (+) 1311 WP_025807606.1 phage portal protein -
  I6G80_RS07150 (I6G80_07150) - 1346779..1347510 (+) 732 WP_035317290.1 head maturation protease, ClpP-related -
  I6G80_RS07155 (I6G80_07155) - 1347549..1348832 (+) 1284 WP_025807602.1 phage major capsid protein -
  I6G80_RS07160 (I6G80_07160) - 1348856..1349281 (+) 426 WP_003185353.1 collagen-like protein -
  I6G80_RS07165 (I6G80_07165) - 1349302..1349604 (+) 303 WP_003185351.1 head-tail connector protein -
  I6G80_RS07170 (I6G80_07170) - 1349594..1349902 (+) 309 WP_003185349.1 phage head closure protein -
  I6G80_RS07175 (I6G80_07175) - 1349902..1350300 (+) 399 WP_006637249.1 HK97-gp10 family putative phage morphogenesis protein -
  I6G80_RS07180 (I6G80_07180) - 1350297..1350680 (+) 384 WP_003185344.1 hypothetical protein -
  I6G80_RS07185 (I6G80_07185) - 1350695..1351312 (+) 618 WP_003185341.1 major tail protein -
  I6G80_RS07190 (I6G80_07190) gpG 1351366..1351728 (+) 363 WP_003185339.1 phage tail assembly chaperone G -
  I6G80_RS07195 (I6G80_07195) - 1351937..1356406 (+) 4470 WP_017474880.1 phage tail tape measure protein -
  I6G80_RS07200 (I6G80_07200) - 1356406..1357242 (+) 837 WP_017474879.1 phage tail family protein -
  I6G80_RS07205 (I6G80_07205) - 1357255..1358967 (+) 1713 WP_017474878.1 phage tail protein -
  I6G80_RS07210 (I6G80_07210) - 1359003..1360958 (+) 1956 WP_095266827.1 right-handed parallel beta-helix repeat-containing protein -
  I6G80_RS07215 (I6G80_07215) - 1360979..1362343 (+) 1365 WP_095266825.1 phage baseplate upper protein -
  I6G80_RS07220 (I6G80_07220) - 1362349..1362669 (+) 321 WP_224990862.1 hypothetical protein -
  I6G80_RS07225 (I6G80_07225) - 1362666..1362851 (+) 186 WP_017474870.1 XkdX family protein -
  I6G80_RS07230 (I6G80_07230) - 1362914..1363183 (+) 270 WP_061578562.1 hemolysin XhlA family protein -
  I6G80_RS07235 (I6G80_07235) - 1363199..1363462 (+) 264 WP_061578561.1 phage holin -
  I6G80_RS07240 (I6G80_07240) - 1363510..1364454 (+) 945 WP_025807656.1 glycoside hydrolase family 25 protein -
  I6G80_RS07245 (I6G80_07245) - 1364485..1364901 (-) 417 WP_006637262.1 immunity 70 family protein -
  I6G80_RS07250 (I6G80_07250) - 1364914..1366530 (-) 1617 WP_025807654.1 ribonuclease YeeF family protein -
  I6G80_RS07255 (I6G80_07255) - 1366723..1366866 (+) 144 WP_021837703.1 hypothetical protein -
  I6G80_RS07260 (I6G80_07260) - 1367121..1367351 (+) 231 WP_025807652.1 helix-turn-helix domain-containing protein -
  I6G80_RS07265 (I6G80_07265) - 1367601..1368248 (+) 648 WP_025807650.1 Panacea domain-containing protein -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10486.36 Da        Isoelectric Point: 7.9620

>NTDB_id=512521 I6G80_RS06955 WP_003185421.1 1320813..1321097(+) (abrB) [Bacillus licheniformis strain FDAARGOS_923]
MKNTGIVRRIDELGRVVLPVEMRRVLNINEKDPLEIYTDGENIILTKYAANMACLMTGDITTKNKTYAGGKIVLSPRGAE
MLLEDMMAALSEKK

Nucleotide


Download         Length: 285 bp        

>NTDB_id=512521 I6G80_RS06955 WP_003185421.1 1320813..1321097(+) (abrB) [Bacillus licheniformis strain FDAARGOS_923]
GTGAAAAATACCGGGATTGTCCGGAGAATCGATGAGCTCGGCAGAGTCGTTCTCCCGGTCGAAATGCGCAGGGTGCTGAA
TATCAATGAAAAGGACCCGCTCGAAATATATACCGACGGCGAAAACATCATTTTGACAAAATACGCCGCAAACATGGCAT
GTTTGATGACCGGCGACATCACCACGAAAAATAAAACGTATGCGGGCGGCAAAATCGTACTCAGCCCGCGCGGAGCGGAA
ATGCTCCTGGAAGATATGATGGCGGCACTGTCAGAAAAGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A1Y0XQV9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

56.044

96.809

0.543