Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   I5367_RS14600 Genome accession   NZ_CP065539
Coordinates   2995393..2995533 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain DGL1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2990393..3000533
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I5367_RS14575 (I5367_14575) - 2990739..2991122 (-) 384 WP_012118312.1 hotdog fold thioesterase -
  I5367_RS14580 (I5367_14580) comA 2991144..2991788 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  I5367_RS14585 (I5367_14585) comP 2991869..2994169 (-) 2301 WP_012118313.1 histidine kinase Regulator
  I5367_RS14590 (I5367_14590) comX 2994183..2994356 (-) 174 WP_012118314.1 competence pheromone ComX -
  I5367_RS14595 (I5367_14595) - 2994325..2995185 (-) 861 WP_012118315.1 polyprenyl synthetase family protein -
  I5367_RS14600 (I5367_14600) degQ 2995393..2995533 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  I5367_RS14605 (I5367_14605) - 2995998..2996339 (+) 342 WP_012118316.1 hypothetical protein -
  I5367_RS14610 (I5367_14610) - 2996346..2997569 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  I5367_RS14615 (I5367_14615) - 2997699..2999165 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  I5367_RS14620 (I5367_14620) - 2999183..2999734 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  I5367_RS14625 (I5367_14625) - 2999831..3000229 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=511786 I5367_RS14600 WP_003152043.1 2995393..2995533(-) (degQ) [Bacillus amyloliquefaciens strain DGL1]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=511786 I5367_RS14600 WP_003152043.1 2995393..2995533(-) (degQ) [Bacillus amyloliquefaciens strain DGL1]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891