Detailed information
Overview
| Name | amiF | Type | Regulator |
| Locus tag | STT55_RS07025 | Genome accession | NZ_CP065502 |
| Coordinates | 1347903..1348073 (-) | Length | 56 a.a. |
| NCBI ID | WP_014608546.1 | Uniprot ID | A0A2U2MH52 |
| Organism | Streptococcus thermophilus strain ST55 | ||
| Function | internalize XIP (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1325517..1391966 | 1347903..1348073 | within | 0 |
Gene organization within MGE regions
Location: 1325517..1391966
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| STT55_RS06920 (STT55_06870) | liaF | 1325525..1326223 (-) | 699 | WP_011226289.1 | cell wall-active antibiotics response protein LiaF | - |
| STT55_RS06925 | - | 1326478..1326645 (-) | 168 | WP_224103618.1 | potassium channel family protein | - |
| STT55_RS06930 (STT55_06880) | stkP/pknB | 1327282..1329153 (-) | 1872 | WP_173940600.1 | Stk1 family PASTA domain-containing Ser/Thr kinase | Regulator |
| STT55_RS06935 (STT55_06885) | - | 1329153..1329890 (-) | 738 | WP_002946881.1 | Stp1/IreP family PP2C-type Ser/Thr phosphatase | - |
| STT55_RS06940 (STT55_06890) | rsmB | 1329934..1331256 (-) | 1323 | WP_014608533.1 | 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB | - |
| STT55_RS06945 (STT55_06895) | fmt | 1331246..1332181 (-) | 936 | WP_173940601.1 | methionyl-tRNA formyltransferase | - |
| STT55_RS06950 (STT55_06900) | - | 1332199..1334595 (-) | 2397 | WP_011681408.1 | primosomal protein N' | - |
| STT55_RS06955 (STT55_06905) | rpoZ | 1334737..1335051 (-) | 315 | WP_002951415.1 | DNA-directed RNA polymerase subunit omega | - |
| STT55_RS06960 (STT55_06910) | gmk | 1335073..1335702 (-) | 630 | WP_173940602.1 | guanylate kinase | - |
| STT55_RS06965 (STT55_06915) | ftsY | 1335935..1337326 (-) | 1392 | WP_011681410.1 | signal recognition particle-docking protein FtsY | - |
| STT55_RS06970 (STT55_06920) | - | 1337337..1338155 (-) | 819 | WP_011681411.1 | Cof-type HAD-IIB family hydrolase | - |
| STT55_RS06975 (STT55_06925) | - | 1338148..1338942 (-) | 795 | WP_173940603.1 | HAD family hydrolase | - |
| STT55_RS06980 (STT55_06930) | - | 1339126..1339503 (+) | 378 | WP_173940604.1 | GntR family transcriptional regulator | - |
| STT55_RS06985 (STT55_06935) | - | 1339508..1340206 (+) | 699 | WP_173940605.1 | ABC transporter ATP-binding protein | - |
| STT55_RS06990 (STT55_06940) | - | 1340218..1341003 (+) | 786 | WP_173940606.1 | ABC transporter permease | - |
| STT55_RS06995 (STT55_06945) | amiF | 1341053..1341982 (-) | 930 | WP_002951426.1 | ATP-binding cassette domain-containing protein | Regulator |
| STT55_RS07000 (STT55_06950) | amiE | 1341975..1343060 (-) | 1086 | WP_011226304.1 | ABC transporter ATP-binding protein | Regulator |
| STT55_RS07005 (STT55_06955) | amiD | 1343070..1343996 (-) | 927 | WP_002946409.1 | oligopeptide ABC transporter permease OppC | Regulator |
| STT55_RS07010 (STT55_06960) | amiC | 1343996..1345489 (-) | 1494 | WP_002946410.1 | ABC transporter permease | Regulator |
| STT55_RS07015 (STT55_06965) | amiA | 1345551..1347518 (-) | 1968 | WP_347229913.1 | peptide ABC transporter substrate-binding protein | Regulator |
| STT55_RS07020 (STT55_06970) | - | 1347722..1347912 (-) | 191 | Protein_1329 | IS3 family transposase | - |
| STT55_RS07025 (STT55_06975) | amiF | 1347903..1348073 (-) | 171 | WP_014608546.1 | hypothetical protein | Regulator |
| STT55_RS07030 (STT55_06980) | amiF | 1348086..1348322 (-) | 237 | WP_308123564.1 | ABC transporter ATP-binding protein | Regulator |
| STT55_RS07035 (STT55_06985) | - | 1348302..1348662 (-) | 361 | Protein_1332 | TatD family hydrolase | - |
| STT55_RS07040 (STT55_06990) | - | 1349011..1350216 (+) | 1206 | WP_011227415.1 | OFA family MFS transporter | - |
| STT55_RS07045 (STT55_06995) | - | 1350263..1351615 (-) | 1353 | Protein_1334 | IS3 family transposase | - |
| STT55_RS07050 (STT55_07000) | pta | 1351701..1352684 (-) | 984 | WP_011227420.1 | phosphate acetyltransferase | - |
| STT55_RS07055 (STT55_07005) | - | 1352698..1353594 (-) | 897 | WP_011226316.1 | RluA family pseudouridine synthase | - |
| STT55_RS07060 (STT55_07010) | - | 1353591..1354427 (-) | 837 | WP_041827075.1 | NAD kinase | - |
| STT55_RS07065 (STT55_07015) | - | 1354399..1355073 (-) | 675 | WP_002951443.1 | GTP pyrophosphokinase family protein | - |
| STT55_RS07070 (STT55_07020) | - | 1355169..1355744 (+) | 576 | WP_002951444.1 | CYTH domain-containing protein | - |
| STT55_RS07075 (STT55_07025) | - | 1356109..1357080 (+) | 972 | WP_002951446.1 | ribose-phosphate diphosphokinase | - |
| STT55_RS07080 (STT55_07030) | - | 1357084..1358196 (+) | 1113 | WP_002948029.1 | cysteine desulfurase family protein | - |
| STT55_RS07085 (STT55_07035) | - | 1358198..1358545 (+) | 348 | WP_002948028.1 | DUF1831 domain-containing protein | - |
| STT55_RS07090 (STT55_07040) | - | 1358689..1359348 (+) | 660 | WP_173940607.1 | redox-sensing transcriptional repressor Rex | - |
| STT55_RS07095 (STT55_07045) | - | 1359341..1360036 (+) | 696 | WP_173940608.1 | gamma-glutamyl-gamma-aminobutyrate hydrolase family protein | - |
| STT55_RS07100 (STT55_07050) | radC | 1360089..1360775 (-) | 687 | WP_011226324.1 | DNA repair protein RadC | - |
| STT55_RS07105 (STT55_07055) | - | 1360824..1362608 (-) | 1785 | WP_173940609.1 | rhamnan synthesis F family protein | - |
| STT55_RS07110 (STT55_07060) | - | 1362605..1363660 (-) | 1056 | WP_002948022.1 | glycosyltransferase | - |
| STT55_RS07115 (STT55_07065) | - | 1363680..1364885 (-) | 1206 | WP_014727633.1 | ABC transporter ATP-binding protein | - |
| STT55_RS07120 (STT55_07070) | - | 1364885..1365694 (-) | 810 | WP_173940610.1 | ABC transporter permease | - |
| STT55_RS07125 (STT55_07075) | - | 1365678..1366634 (-) | 957 | WP_014727634.1 | glycosyltransferase family 2 protein | - |
| STT55_RS07130 (STT55_07080) | - | 1366631..1367779 (-) | 1149 | WP_002948014.1 | glycosyltransferase family 1 protein | - |
| STT55_RS07135 (STT55_07085) | - | 1367888..1368898 (-) | 1011 | WP_173940611.1 | glycosyltransferase family A protein | - |
| STT55_RS07140 (STT55_07090) | - | 1368898..1370172 (-) | 1275 | WP_022097028.1 | polysaccharide biosynthesis protein transporter | - |
| STT55_RS07145 (STT55_07095) | - | 1370165..1370497 (-) | 333 | WP_011226332.1 | DUF2304 domain-containing protein | - |
| STT55_RS07150 (STT55_07100) | - | 1370503..1371198 (-) | 696 | WP_173940715.1 | glycosyltransferase family 2 protein | - |
| STT55_RS07155 (STT55_07105) | rfbD | 1371275..1372126 (-) | 852 | WP_022097027.1 | dTDP-4-dehydrorhamnose reductase | - |
| STT55_RS07160 (STT55_07110) | - | 1372203..1373537 (-) | 1335 | WP_002946422.1 | DUF6056 family protein | - |
| STT55_RS07165 (STT55_07115) | - | 1373650..1374570 (-) | 921 | WP_116920321.1 | glycosyltransferase family 2 protein | - |
| STT55_RS07170 (STT55_07120) | - | 1374630..1376045 (-) | 1416 | WP_096811580.1 | DUF2142 domain-containing protein | - |
| STT55_RS07175 (STT55_07125) | - | 1376379..1376714 (-) | 336 | WP_173940612.1 | metal-sulfur cluster assembly factor | - |
| STT55_RS07180 (STT55_07130) | rpoD | 1376768..1377877 (-) | 1110 | WP_011226338.1 | RNA polymerase sigma factor RpoD | - |
| STT55_RS07185 (STT55_07135) | dnaG | 1377881..1379692 (-) | 1812 | WP_011681448.1 | DNA primase | - |
| STT55_RS07190 (STT55_07140) | mscL | 1379833..1379916 (+) | 84 | Protein_1363 | large conductance mechanosensitive channel protein MscL | - |
| STT55_RS07195 (STT55_07145) | rpsU | 1380076..1380252 (-) | 177 | WP_082309068.1 | 30S ribosomal protein S21 | - |
| STT55_RS07200 (STT55_07150) | - | 1380447..1381241 (-) | 795 | WP_022097025.1 | ABC transporter substrate-binding protein | - |
| STT55_RS07205 (STT55_07155) | - | 1381303..1382412 (-) | 1110 | WP_022097024.1 | aminotransferase | - |
| STT55_RS07210 (STT55_07160) | - | 1382758..1383555 (-) | 798 | WP_022097023.1 | transporter substrate-binding domain-containing protein | - |
| STT55_RS07215 (STT55_07165) | - | 1383552..1384382 (-) | 831 | WP_022097022.1 | transporter substrate-binding domain-containing protein | - |
| STT55_RS07220 (STT55_07170) | - | 1384596..1385060 (-) | 465 | WP_011681454.1 | 8-oxo-dGTP diphosphatase | - |
| STT55_RS07225 (STT55_07175) | uvrB | 1385105..1387096 (-) | 1992 | WP_002953358.1 | excinuclease ABC subunit UvrB | - |
| STT55_RS07230 (STT55_07180) | - | 1387243..1387710 (-) | 468 | WP_022097021.1 | hypothetical protein | - |
| STT55_RS07235 (STT55_07185) | - | 1387783..1388719 (-) | 937 | Protein_1372 | type II CAAX endopeptidase family protein | - |
| STT55_RS07240 (STT55_07190) | - | 1388918..1391128 (+) | 2211 | WP_173940613.1 | ABC transporter substrate-binding protein/permease | - |
| STT55_RS07245 (STT55_07195) | - | 1391128..1391868 (+) | 741 | WP_002945131.1 | amino acid ABC transporter ATP-binding protein | - |
Sequence
Protein
Download Length: 56 a.a. Molecular weight: 6495.42 Da Isoelectric Point: 4.6436
>NTDB_id=511270 STT55_RS07025 WP_014608546.1 1347903..1348073(-) (amiF) [Streptococcus thermophilus strain ST55]
MEVAETEELYNNPIHPYTKSLLSAVPIPDPILERKKVLKVYDPNQHDYSVDKPEMV
MEVAETEELYNNPIHPYTKSLLSAVPIPDPILERKKVLKVYDPNQHDYSVDKPEMV
Nucleotide
Download Length: 171 bp
>NTDB_id=511270 STT55_RS07025 WP_014608546.1 1347903..1348073(-) (amiF) [Streptococcus thermophilus strain ST55]
GTGGAAGTTGCTGAGACAGAAGAGCTCTACAACAATCCTATCCATCCTTACACCAAGTCACTCTTGTCTGCTGTTCCTAT
TCCAGATCCAATCTTGGAACGTAAGAAAGTCTTGAAGGTTTATGATCCAAACCAACACGACTATTCGGTTGATAAACCAG
AAATGGTATGA
GTGGAAGTTGCTGAGACAGAAGAGCTCTACAACAATCCTATCCATCCTTACACCAAGTCACTCTTGTCTGCTGTTCCTAT
TCCAGATCCAATCTTGGAACGTAAGAAAGTCTTGAAGGTTTATGATCCAAACCAACACGACTATTCGGTTGATAAACCAG
AAATGGTATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| amiF | Streptococcus thermophilus LMG 18311 |
98.214 |
100 |
0.982 |
| amiF | Streptococcus thermophilus LMD-9 |
98.214 |
100 |
0.982 |
| amiF | Streptococcus salivarius strain HSISS4 |
98.214 |
100 |
0.982 |