Detailed information    

insolico Bioinformatically predicted

Overview


Name   amiF   Type   Regulator
Locus tag   STT55_RS07025 Genome accession   NZ_CP065502
Coordinates   1347903..1348073 (-) Length   56 a.a.
NCBI ID   WP_014608546.1    Uniprot ID   A0A2U2MH52
Organism   Streptococcus thermophilus strain ST55     
Function   internalize XIP (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1325517..1391966 1347903..1348073 within 0


Gene organization within MGE regions


Location: 1325517..1391966
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  STT55_RS06920 (STT55_06870) liaF 1325525..1326223 (-) 699 WP_011226289.1 cell wall-active antibiotics response protein LiaF -
  STT55_RS06925 - 1326478..1326645 (-) 168 WP_224103618.1 potassium channel family protein -
  STT55_RS06930 (STT55_06880) stkP/pknB 1327282..1329153 (-) 1872 WP_173940600.1 Stk1 family PASTA domain-containing Ser/Thr kinase Regulator
  STT55_RS06935 (STT55_06885) - 1329153..1329890 (-) 738 WP_002946881.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  STT55_RS06940 (STT55_06890) rsmB 1329934..1331256 (-) 1323 WP_014608533.1 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -
  STT55_RS06945 (STT55_06895) fmt 1331246..1332181 (-) 936 WP_173940601.1 methionyl-tRNA formyltransferase -
  STT55_RS06950 (STT55_06900) - 1332199..1334595 (-) 2397 WP_011681408.1 primosomal protein N' -
  STT55_RS06955 (STT55_06905) rpoZ 1334737..1335051 (-) 315 WP_002951415.1 DNA-directed RNA polymerase subunit omega -
  STT55_RS06960 (STT55_06910) gmk 1335073..1335702 (-) 630 WP_173940602.1 guanylate kinase -
  STT55_RS06965 (STT55_06915) ftsY 1335935..1337326 (-) 1392 WP_011681410.1 signal recognition particle-docking protein FtsY -
  STT55_RS06970 (STT55_06920) - 1337337..1338155 (-) 819 WP_011681411.1 Cof-type HAD-IIB family hydrolase -
  STT55_RS06975 (STT55_06925) - 1338148..1338942 (-) 795 WP_173940603.1 HAD family hydrolase -
  STT55_RS06980 (STT55_06930) - 1339126..1339503 (+) 378 WP_173940604.1 GntR family transcriptional regulator -
  STT55_RS06985 (STT55_06935) - 1339508..1340206 (+) 699 WP_173940605.1 ABC transporter ATP-binding protein -
  STT55_RS06990 (STT55_06940) - 1340218..1341003 (+) 786 WP_173940606.1 ABC transporter permease -
  STT55_RS06995 (STT55_06945) amiF 1341053..1341982 (-) 930 WP_002951426.1 ATP-binding cassette domain-containing protein Regulator
  STT55_RS07000 (STT55_06950) amiE 1341975..1343060 (-) 1086 WP_011226304.1 ABC transporter ATP-binding protein Regulator
  STT55_RS07005 (STT55_06955) amiD 1343070..1343996 (-) 927 WP_002946409.1 oligopeptide ABC transporter permease OppC Regulator
  STT55_RS07010 (STT55_06960) amiC 1343996..1345489 (-) 1494 WP_002946410.1 ABC transporter permease Regulator
  STT55_RS07015 (STT55_06965) amiA 1345551..1347518 (-) 1968 WP_347229913.1 peptide ABC transporter substrate-binding protein Regulator
  STT55_RS07020 (STT55_06970) - 1347722..1347912 (-) 191 Protein_1329 IS3 family transposase -
  STT55_RS07025 (STT55_06975) amiF 1347903..1348073 (-) 171 WP_014608546.1 hypothetical protein Regulator
  STT55_RS07030 (STT55_06980) amiF 1348086..1348322 (-) 237 WP_308123564.1 ABC transporter ATP-binding protein Regulator
  STT55_RS07035 (STT55_06985) - 1348302..1348662 (-) 361 Protein_1332 TatD family hydrolase -
  STT55_RS07040 (STT55_06990) - 1349011..1350216 (+) 1206 WP_011227415.1 OFA family MFS transporter -
  STT55_RS07045 (STT55_06995) - 1350263..1351615 (-) 1353 Protein_1334 IS3 family transposase -
  STT55_RS07050 (STT55_07000) pta 1351701..1352684 (-) 984 WP_011227420.1 phosphate acetyltransferase -
  STT55_RS07055 (STT55_07005) - 1352698..1353594 (-) 897 WP_011226316.1 RluA family pseudouridine synthase -
  STT55_RS07060 (STT55_07010) - 1353591..1354427 (-) 837 WP_041827075.1 NAD kinase -
  STT55_RS07065 (STT55_07015) - 1354399..1355073 (-) 675 WP_002951443.1 GTP pyrophosphokinase family protein -
  STT55_RS07070 (STT55_07020) - 1355169..1355744 (+) 576 WP_002951444.1 CYTH domain-containing protein -
  STT55_RS07075 (STT55_07025) - 1356109..1357080 (+) 972 WP_002951446.1 ribose-phosphate diphosphokinase -
  STT55_RS07080 (STT55_07030) - 1357084..1358196 (+) 1113 WP_002948029.1 cysteine desulfurase family protein -
  STT55_RS07085 (STT55_07035) - 1358198..1358545 (+) 348 WP_002948028.1 DUF1831 domain-containing protein -
  STT55_RS07090 (STT55_07040) - 1358689..1359348 (+) 660 WP_173940607.1 redox-sensing transcriptional repressor Rex -
  STT55_RS07095 (STT55_07045) - 1359341..1360036 (+) 696 WP_173940608.1 gamma-glutamyl-gamma-aminobutyrate hydrolase family protein -
  STT55_RS07100 (STT55_07050) radC 1360089..1360775 (-) 687 WP_011226324.1 DNA repair protein RadC -
  STT55_RS07105 (STT55_07055) - 1360824..1362608 (-) 1785 WP_173940609.1 rhamnan synthesis F family protein -
  STT55_RS07110 (STT55_07060) - 1362605..1363660 (-) 1056 WP_002948022.1 glycosyltransferase -
  STT55_RS07115 (STT55_07065) - 1363680..1364885 (-) 1206 WP_014727633.1 ABC transporter ATP-binding protein -
  STT55_RS07120 (STT55_07070) - 1364885..1365694 (-) 810 WP_173940610.1 ABC transporter permease -
  STT55_RS07125 (STT55_07075) - 1365678..1366634 (-) 957 WP_014727634.1 glycosyltransferase family 2 protein -
  STT55_RS07130 (STT55_07080) - 1366631..1367779 (-) 1149 WP_002948014.1 glycosyltransferase family 1 protein -
  STT55_RS07135 (STT55_07085) - 1367888..1368898 (-) 1011 WP_173940611.1 glycosyltransferase family A protein -
  STT55_RS07140 (STT55_07090) - 1368898..1370172 (-) 1275 WP_022097028.1 polysaccharide biosynthesis protein transporter -
  STT55_RS07145 (STT55_07095) - 1370165..1370497 (-) 333 WP_011226332.1 DUF2304 domain-containing protein -
  STT55_RS07150 (STT55_07100) - 1370503..1371198 (-) 696 WP_173940715.1 glycosyltransferase family 2 protein -
  STT55_RS07155 (STT55_07105) rfbD 1371275..1372126 (-) 852 WP_022097027.1 dTDP-4-dehydrorhamnose reductase -
  STT55_RS07160 (STT55_07110) - 1372203..1373537 (-) 1335 WP_002946422.1 DUF6056 family protein -
  STT55_RS07165 (STT55_07115) - 1373650..1374570 (-) 921 WP_116920321.1 glycosyltransferase family 2 protein -
  STT55_RS07170 (STT55_07120) - 1374630..1376045 (-) 1416 WP_096811580.1 DUF2142 domain-containing protein -
  STT55_RS07175 (STT55_07125) - 1376379..1376714 (-) 336 WP_173940612.1 metal-sulfur cluster assembly factor -
  STT55_RS07180 (STT55_07130) rpoD 1376768..1377877 (-) 1110 WP_011226338.1 RNA polymerase sigma factor RpoD -
  STT55_RS07185 (STT55_07135) dnaG 1377881..1379692 (-) 1812 WP_011681448.1 DNA primase -
  STT55_RS07190 (STT55_07140) mscL 1379833..1379916 (+) 84 Protein_1363 large conductance mechanosensitive channel protein MscL -
  STT55_RS07195 (STT55_07145) rpsU 1380076..1380252 (-) 177 WP_082309068.1 30S ribosomal protein S21 -
  STT55_RS07200 (STT55_07150) - 1380447..1381241 (-) 795 WP_022097025.1 ABC transporter substrate-binding protein -
  STT55_RS07205 (STT55_07155) - 1381303..1382412 (-) 1110 WP_022097024.1 aminotransferase -
  STT55_RS07210 (STT55_07160) - 1382758..1383555 (-) 798 WP_022097023.1 transporter substrate-binding domain-containing protein -
  STT55_RS07215 (STT55_07165) - 1383552..1384382 (-) 831 WP_022097022.1 transporter substrate-binding domain-containing protein -
  STT55_RS07220 (STT55_07170) - 1384596..1385060 (-) 465 WP_011681454.1 8-oxo-dGTP diphosphatase -
  STT55_RS07225 (STT55_07175) uvrB 1385105..1387096 (-) 1992 WP_002953358.1 excinuclease ABC subunit UvrB -
  STT55_RS07230 (STT55_07180) - 1387243..1387710 (-) 468 WP_022097021.1 hypothetical protein -
  STT55_RS07235 (STT55_07185) - 1387783..1388719 (-) 937 Protein_1372 type II CAAX endopeptidase family protein -
  STT55_RS07240 (STT55_07190) - 1388918..1391128 (+) 2211 WP_173940613.1 ABC transporter substrate-binding protein/permease -
  STT55_RS07245 (STT55_07195) - 1391128..1391868 (+) 741 WP_002945131.1 amino acid ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 56 a.a.        Molecular weight: 6495.42 Da        Isoelectric Point: 4.6436

>NTDB_id=511270 STT55_RS07025 WP_014608546.1 1347903..1348073(-) (amiF) [Streptococcus thermophilus strain ST55]
MEVAETEELYNNPIHPYTKSLLSAVPIPDPILERKKVLKVYDPNQHDYSVDKPEMV

Nucleotide


Download         Length: 171 bp        

>NTDB_id=511270 STT55_RS07025 WP_014608546.1 1347903..1348073(-) (amiF) [Streptococcus thermophilus strain ST55]
GTGGAAGTTGCTGAGACAGAAGAGCTCTACAACAATCCTATCCATCCTTACACCAAGTCACTCTTGTCTGCTGTTCCTAT
TCCAGATCCAATCTTGGAACGTAAGAAAGTCTTGAAGGTTTATGATCCAAACCAACACGACTATTCGGTTGATAAACCAG
AAATGGTATGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A2U2MH52

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  amiF Streptococcus thermophilus LMG 18311

98.214

100

0.982

  amiF Streptococcus thermophilus LMD-9

98.214

100

0.982

  amiF Streptococcus salivarius strain HSISS4

98.214

100

0.982