Detailed information
Bioinformatically predicted
Overview
| Name | comA | Type | Regulator |
| Locus tag | STT128_RS01565 | Genome accession | NZ_CP065500 |
| Coordinates | 275920..276129 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain ST128 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 270920..281129
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| STT128_RS01540 (STT128_01555) | - | 271357..271866 (+) | 510 | WP_014607952.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| STT128_RS01545 (STT128_01560) | - | 272178..272735 (+) | 558 | WP_002949523.1 | ECF transporter S component | - |
| STT128_RS01550 (STT128_01565) | - | 272738..273388 (+) | 651 | WP_084829333.1 | phosphatase PAP2 family protein | - |
| STT128_RS01555 (STT128_01570) | comR | 273583..274482 (+) | 900 | WP_002946143.1 | helix-turn-helix domain-containing protein | Regulator |
| STT128_RS01560 | - | 274720..275898 (+) | 1179 | Protein_254 | ABC transporter transmembrane domain-containing protein | - |
| STT128_RS01565 | comA | 275920..276129 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| STT128_RS01570 (STT128_01595) | - | 276184..276752 (+) | 569 | Protein_256 | ATP-binding cassette domain-containing protein | - |
| STT128_RS01575 (STT128_01600) | - | 276860..277177 (+) | 318 | WP_011225454.1 | DUF805 domain-containing protein | - |
| STT128_RS01580 | - | 277664..278560 (-) | 897 | WP_224102957.1 | urease cluster protein | - |
| STT128_RS01585 (STT128_01610) | - | 278965..279480 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| STT128_RS01590 (STT128_01615) | - | 279505..279807 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| STT128_RS01595 (STT128_01620) | - | 279819..280130 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=511180 STT128_RS01565 WP_002946147.1 275920..276129(+) (comA) [Streptococcus thermophilus strain ST128]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=511180 STT128_RS01565 WP_002946147.1 275920..276129(+) (comA) [Streptococcus thermophilus strain ST128]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |