Detailed information    

insolico Bioinformatically predicted

Overview


Name   sepM   Type   Regulator
Locus tag   STAVA1121_RS07900 Genome accession   NZ_CP065488
Coordinates   1492678..1493754 (-) Length   358 a.a.
NCBI ID   WP_022096499.1    Uniprot ID   -
Organism   Streptococcus thermophilus strain AVA1121     
Function   processing of CSP (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1471800..1557808 1492678..1493754 within 0


Gene organization within MGE regions


Location: 1471800..1557808
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  STAVA1121_RS07785 (STAVA1121_07675) gatA 1473066..1474532 (-) 1467 WP_011681542.1 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA -
  STAVA1121_RS07790 (STAVA1121_07680) gatC 1474532..1474834 (-) 303 WP_002884769.1 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC -
  STAVA1121_RS07795 - 1474974..1475135 (-) 162 WP_224103235.1 hypothetical protein -
  STAVA1121_RS07800 - 1475167..1475439 (-) 273 WP_224103183.1 glycosyltransferase -
  STAVA1121_RS07805 (STAVA1121_07695) - 1475766..1477207 (-) 1442 Protein_1483 6-phospho-beta-glucosidase -
  STAVA1121_RS07810 (STAVA1121_07700) msrA 1477360..1477869 (-) 510 WP_041829085.1 peptide-methionine (S)-S-oxide reductase MsrA -
  STAVA1121_RS07815 (STAVA1121_07705) - 1477881..1478729 (-) 849 WP_179967094.1 MetQ/NlpA family ABC transporter substrate-binding protein -
  STAVA1121_RS07820 (STAVA1121_07710) - 1478853..1479404 (-) 552 WP_173940634.1 isochorismatase family cysteine hydrolase -
  STAVA1121_RS07825 (STAVA1121_07715) codY 1479466..1480251 (-) 786 WP_002951720.1 GTP-sensing pleiotropic transcriptional regulator CodY -
  STAVA1121_RS07830 (STAVA1121_07720) - 1480511..1481725 (-) 1215 WP_011226456.1 pyridoxal phosphate-dependent aminotransferase -
  STAVA1121_RS07835 (STAVA1121_07725) - 1482080..1482532 (+) 453 WP_180477136.1 universal stress protein -
  STAVA1121_RS07840 - 1482745..1482894 (+) 150 WP_232557033.1 hypothetical protein -
  STAVA1121_RS07845 - 1483101..1483283 (+) 183 Protein_1491 IS30 family transposase -
  STAVA1121_RS07850 (STAVA1121_07735) - 1483355..1483528 (-) 174 WP_011681546.1 hypothetical protein -
  STAVA1121_RS07855 (STAVA1121_07740) - 1483589..1483963 (-) 375 WP_141326717.1 hypothetical protein -
  STAVA1121_RS07860 (STAVA1121_07745) pflA 1484173..1484973 (-) 801 WP_002946980.1 pyruvate formate-lyase-activating protein -
  STAVA1121_RS07865 (STAVA1121_07750) - 1485161..1485271 (-) 111 WP_014621906.1 LPXTG cell wall anchor domain-containing protein -
  STAVA1121_RS07870 (STAVA1121_07755) - 1485965..1487287 (-) 1323 Protein_1496 hemolysin family protein -
  STAVA1121_RS07875 (STAVA1121_07760) - 1487399..1488197 (+) 799 Protein_1497 ABC transporter ATP-binding protein -
  STAVA1121_RS07880 (STAVA1121_07765) - 1488790..1490856 (-) 2067 WP_173940635.1 sodium:proton antiporter -
  STAVA1121_RS07885 (STAVA1121_07770) - 1490865..1491107 (-) 243 WP_022096501.1 hypothetical protein -
  STAVA1121_RS07890 (STAVA1121_07775) - 1491104..1491652 (-) 549 WP_011226462.1 class I SAM-dependent methyltransferase -
  STAVA1121_RS07895 (STAVA1121_07780) - 1491649..1492593 (-) 945 WP_022096500.1 TIGR01212 family radical SAM protein -
  STAVA1121_RS07900 (STAVA1121_07785) sepM 1492678..1493754 (-) 1077 WP_022096499.1 SepM family pheromone-processing serine protease Regulator
  STAVA1121_RS07905 (STAVA1121_07790) coaD 1493732..1494229 (-) 498 WP_022096498.1 pantetheine-phosphate adenylyltransferase -
  STAVA1121_RS07910 (STAVA1121_07795) rsmD 1494263..1494838 (-) 576 WP_347131594.1 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD -
  STAVA1121_RS07915 (STAVA1121_07800) trxB 1494953..1495906 (-) 954 WP_255136104.1 thioredoxin-disulfide reductase -
  STAVA1121_RS07920 (STAVA1121_07805) - 1495939..1496163 (-) 225 WP_087010135.1 DUF4059 family protein -
  STAVA1121_RS07925 (STAVA1121_07810) - 1496378..1497121 (-) 744 WP_164178279.1 amino acid ABC transporter ATP-binding protein -
  STAVA1121_RS07930 (STAVA1121_07815) - 1497121..1498044 (-) 924 WP_347131191.1 amino acid ABC transporter permease -
  STAVA1121_RS07935 (STAVA1121_07820) - 1498255..1499085 (-) 831 WP_347131192.1 transporter substrate-binding domain-containing protein -
  STAVA1121_RS07940 (STAVA1121_07825) - 1499546..1499779 (-) 234 WP_002947030.1 hypothetical protein -
  STAVA1121_RS07945 (STAVA1121_07830) dinB 1500077..1501180 (-) 1104 WP_347131193.1 DNA polymerase IV -
  STAVA1121_RS07950 (STAVA1121_07835) pflB 1501459..1503768 (+) 2310 WP_002947035.1 formate C-acetyltransferase -
  STAVA1121_RS07955 (STAVA1121_07840) - 1504035..1504819 (+) 785 Protein_1513 carbonic anhydrase family protein -
  STAVA1121_RS07960 (STAVA1121_07845) - 1504870..1505322 (+) 453 WP_180481095.1 GNAT family N-acetyltransferase -
  STAVA1121_RS07965 (STAVA1121_07850) - 1505674..1505979 (-) 306 WP_347131195.1 restriction endonuclease subunit S -
  STAVA1121_RS07970 (STAVA1121_07855) mobV 1506004..1506512 (-) 509 Protein_1516 MobV family relaxase -
  STAVA1121_RS07975 (STAVA1121_07860) - 1506993..1507542 (-) 550 Protein_1517 tyrosine-type recombinase/integrase -
  STAVA1121_RS07980 (STAVA1121_07865) - 1507674..1508360 (-) 687 WP_347131196.1 hypothetical protein -
  STAVA1121_RS07985 (STAVA1121_07870) fetB 1508436..1509191 (-) 756 WP_347131197.1 iron export ABC transporter permease subunit FetB -
  STAVA1121_RS07990 (STAVA1121_07875) - 1509188..1509838 (-) 651 WP_022096490.1 ATP-binding cassette domain-containing protein -
  STAVA1121_RS07995 (STAVA1121_07880) - 1510040..1510996 (-) 957 WP_180477144.1 serine hydrolase domain-containing protein -
  STAVA1121_RS08000 (STAVA1121_07885) - 1510996..1511751 (-) 756 WP_347131198.1 CppA family protein -
  STAVA1121_RS08005 - 1512034..1512171 (+) 138 WP_347131199.1 hypothetical protein -
  STAVA1121_RS08010 - 1512172..1512396 (+) 225 WP_347131201.1 CPBP family intramembrane glutamic endopeptidase -
  STAVA1121_RS08015 (STAVA1121_07895) gla 1512483..1513346 (-) 864 WP_002951781.1 aquaglyceroporin Gla -
  STAVA1121_RS08020 (STAVA1121_07900) - 1513467..1515734 (+) 2268 WP_141326711.1 Xaa-Pro dipeptidyl-peptidase -
  STAVA1121_RS08025 (STAVA1121_07905) - 1515814..1516194 (-) 381 WP_002951783.1 hypothetical protein -
  STAVA1121_RS08030 (STAVA1121_07910) - 1516319..1516582 (-) 264 WP_002945924.1 hypothetical protein -
  STAVA1121_RS08035 (STAVA1121_07915) - 1516904..1517200 (-) 297 WP_347131204.1 bacteriocin immunity protein -
  STAVA1121_RS08040 (STAVA1121_07920) - 1517365..1518261 (-) 897 WP_347131205.1 thioredoxin family protein -
  STAVA1121_RS08045 (STAVA1121_07925) - 1518483..1520053 (+) 1571 Protein_1531 IS3-like element ISSth1b family transposase -
  STAVA1121_RS08050 (STAVA1121_07930) - 1520199..1520441 (-) 243 WP_002948868.1 Blp family class II bacteriocin -
  STAVA1121_RS08055 - 1520692..1521093 (-) 402 WP_011226490.1 hypothetical protein -
  STAVA1121_RS08060 (STAVA1121_07935) - 1522061..1522267 (-) 207 WP_347131206.1 bacteriocin class II family protein -
  STAVA1121_RS08065 (STAVA1121_07940) - 1522518..1523249 (+) 732 WP_002948869.1 LytTR family DNA-binding domain-containing protein -
  STAVA1121_RS08070 - 1523786..1524589 (+) 804 WP_224103634.1 ATP-binding protein -
  STAVA1121_RS08075 (STAVA1121_07950) - 1524607..1524768 (-) 162 WP_011226496.1 ComC/BlpC family leader-containing pheromone/bacteriocin -
  STAVA1121_RS08080 (STAVA1121_07955) - 1524783..1526150 (-) 1368 WP_084829837.1 bacteriocin secretion accessory protein -
  STAVA1121_RS08085 (STAVA1121_07960) comA/nlmT 1526166..1528256 (-) 2091 WP_347131208.1 peptide cleavage/export ABC transporter Regulator
  STAVA1121_RS08090 (STAVA1121_07965) - 1529332..1531077 (-) 1746 WP_347131210.1 ABC transporter ATP-binding protein -
  STAVA1121_RS08095 (STAVA1121_07970) - 1531070..1532827 (-) 1758 WP_347131211.1 ABC transporter transmembrane domain-containing protein -
  STAVA1121_RS08100 - 1533015..1533221 (-) 207 WP_002948879.1 hypothetical protein -
  STAVA1121_RS08105 (STAVA1121_07980) - 1533426..1533953 (-) 528 WP_347131213.1 VanZ family protein -
  STAVA1121_RS08110 (STAVA1121_07985) rlmN 1533955..1535064 (-) 1110 WP_232972486.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  STAVA1121_RS08115 (STAVA1121_07990) - 1535128..1535850 (-) 723 WP_347131214.1 YutD family protein -
  STAVA1121_RS08120 (STAVA1121_07995) - 1535905..1537260 (-) 1356 WP_002948886.1 metallophosphatase -
  STAVA1121_RS08125 (STAVA1121_08000) - 1537539..1537778 (-) 240 WP_041828333.1 hypothetical protein -
  STAVA1121_RS08130 (STAVA1121_08005) - 1538109..1539452 (-) 1344 WP_347131216.1 DEAD/DEAH box helicase -
  STAVA1121_RS08135 (STAVA1121_08010) mraY 1539527..1540549 (-) 1023 WP_011227524.1 phospho-N-acetylmuramoyl-pentapeptide- transferase -
  STAVA1121_RS08140 (STAVA1121_08015) pbp2X 1540551..1542817 (-) 2267 Protein_1550 penicillin-binding protein PBP2X -
  STAVA1121_RS08145 (STAVA1121_08020) ftsL 1542821..1543141 (-) 321 WP_014608671.1 cell division protein FtsL -
  STAVA1121_RS08150 (STAVA1121_08025) rsmH 1543144..1544094 (-) 951 WP_002888254.1 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH -
  STAVA1121_RS08155 - 1544260..1545246 (-) 987 WP_347131217.1 hypothetical protein -
  STAVA1121_RS08160 (STAVA1121_08045) - 1545885..1546241 (-) 357 WP_014621938.1 DUF805 domain-containing protein -
  STAVA1121_RS08165 (STAVA1121_08050) - 1546460..1546756 (-) 297 WP_347131218.1 hypothetical protein -
  STAVA1121_RS08170 (STAVA1121_08055) - 1547089..1548339 (-) 1251 WP_347131219.1 glutamate-5-semialdehyde dehydrogenase -
  STAVA1121_RS08175 (STAVA1121_08060) proB 1548341..1549144 (-) 804 WP_002948808.1 glutamate 5-kinase -
  STAVA1121_RS08180 (STAVA1121_08065) - 1549265..1550854 (-) 1590 WP_180477154.1 DUF4231 domain-containing protein -
  STAVA1121_RS08185 (STAVA1121_08070) - 1550857..1551588 (-) 732 WP_180477155.1 ABC transporter ATP-binding protein -
  STAVA1121_RS08190 (STAVA1121_08075) - 1551862..1552595 (+) 734 Protein_1560 DUF554 domain-containing protein -
  STAVA1121_RS08195 (STAVA1121_08080) addA 1552988..1556641 (-) 3654 WP_347131220.1 helicase-exonuclease AddAB subunit AddA -

Sequence


Protein


Download         Length: 358 a.a.        Molecular weight: 39202.09 Da        Isoelectric Point: 9.4944

>NTDB_id=510681 STAVA1121_RS07900 WP_022096499.1 1492678..1493754(-) (sepM) [Streptococcus thermophilus strain AVA1121]
MANKTKSKSLLEKMWRIKWWLLSIFTVLFLLFALFFPLNNYYVELPGGAFDTKEVLTVNKKADDSKGSYNFVAVAQTKAT
LALMLYAQFNDFAKLQTAEEATGNYSDEDFMRINQFYMETSQNQAVYQGLTLAGKEVSLEYMGVYVLQVADDSSFKGVLN
IADTVTAVNGKTFDNSTDMIKYVQGLKLGSKVKVTYMRDGKEKTATGKIIKIANGKNGIGIGLTDHTEIKSPENVKFKLD
GVGGPSAGLMFTLAIYDQVSGQDLKAGRKIAGTGTIEKDGAVGDIGGAYLKVKSAADSGADIFFVPNNLVTKEMKKADPD
AKTNYQEAKEAAEKLGTKMKIVPVKTAQEAIDYLKKTK

Nucleotide


Download         Length: 1077 bp        

>NTDB_id=510681 STAVA1121_RS07900 WP_022096499.1 1492678..1493754(-) (sepM) [Streptococcus thermophilus strain AVA1121]
GTGGCAAACAAGACAAAATCTAAATCGCTATTAGAGAAAATGTGGCGTATTAAGTGGTGGTTATTAAGTATTTTTACGGT
ACTTTTCCTCCTTTTTGCCCTCTTTTTCCCGCTCAATAATTACTATGTGGAGCTTCCGGGTGGTGCTTTTGATACCAAGG
AAGTCTTGACAGTGAATAAGAAAGCTGATGATTCTAAGGGCTCCTATAATTTTGTGGCGGTGGCTCAAACCAAGGCGACT
TTGGCCTTGATGCTCTATGCTCAGTTTAATGATTTTGCAAAGCTTCAAACGGCTGAAGAGGCAACTGGAAATTACTCTGA
TGAAGATTTCATGCGCATCAACCAATTTTACATGGAGACTTCTCAAAACCAAGCGGTTTATCAGGGCTTGACTCTGGCTG
GTAAGGAGGTTAGTTTGGAGTATATGGGTGTCTATGTGCTTCAGGTTGCTGATGATTCTAGCTTCAAGGGTGTCCTCAAT
ATTGCTGATACGGTGACGGCTGTTAATGGTAAGACCTTTGATAATTCTACTGACATGATTAAATACGTTCAAGGACTTAA
GCTGGGTTCAAAGGTCAAGGTCACTTATATGAGAGATGGCAAAGAAAAGACTGCTACTGGTAAGATTATTAAGATTGCCA
ATGGCAAAAATGGTATTGGTATCGGCCTAACGGACCATACTGAGATCAAGAGTCCTGAGAATGTTAAGTTTAAACTGGAT
GGTGTCGGTGGGCCAAGTGCTGGTCTTATGTTTACCTTGGCTATTTACGATCAGGTGTCTGGTCAAGACCTCAAGGCTGG
CCGCAAGATTGCTGGTACAGGAACTATTGAAAAAGATGGGGCTGTCGGTGATATCGGTGGGGCCTATCTCAAGGTGAAAT
CTGCGGCTGATAGTGGCGCAGACATTTTCTTCGTGCCAAATAATCTAGTAACTAAGGAAATGAAAAAGGCTGATCCGGAT
GCCAAGACTAATTATCAAGAGGCCAAGGAAGCTGCCGAGAAACTGGGGACCAAGATGAAAATCGTCCCTGTTAAAACAGC
TCAAGAAGCCATTGATTATTTGAAAAAGACTAAATGA

Domains


Predicted by InterproScan.

(137-206)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sepM Streptococcus mutans UA159

63.05

95.251

0.601