Detailed information    

insolico Bioinformatically predicted

Overview

Name   sepM   Type   Regulator
Locus tag   STCNRZ760_RS08060 Genome accession   NZ_CP065482
Coordinates   1539594..1540670 (-) Length   358 a.a.
NCBI ID   WP_022096499.1    Uniprot ID   -
Organism   Streptococcus thermophilus strain CNRZ760     
Function   processing of CSP (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1534281..1604257 1539594..1540670 within 0


Gene organization within MGE regions


Location: 1534281..1604257
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  STCNRZ760_RS08035 (STCNRZ760_07965) - 1534305..1535087 (+) 783 WP_180481091.1 ABC transporter ATP-binding protein -
  STCNRZ760_RS08040 (STCNRZ760_07970) - 1535706..1537772 (-) 2067 WP_180481092.1 sodium:proton antiporter -
  STCNRZ760_RS08045 (STCNRZ760_07975) - 1537781..1538023 (-) 243 WP_022096501.1 hypothetical protein -
  STCNRZ760_RS08050 (STCNRZ760_07980) - 1538020..1538568 (-) 549 WP_004197152.1 class I SAM-dependent methyltransferase -
  STCNRZ760_RS08055 (STCNRZ760_07985) - 1538565..1539509 (-) 945 WP_022096500.1 TIGR01212 family radical SAM protein -
  STCNRZ760_RS08060 (STCNRZ760_07990) sepM 1539594..1540670 (-) 1077 WP_022096499.1 SepM family pheromone-processing serine protease Regulator
  STCNRZ760_RS08065 (STCNRZ760_07995) coaD 1540648..1541145 (-) 498 WP_011226465.1 pantetheine-phosphate adenylyltransferase -
  STCNRZ760_RS08070 (STCNRZ760_08000) rsmD 1541179..1541778 (-) 600 Protein_1537 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD -
  STCNRZ760_RS08075 (STCNRZ760_08005) trxB 1541869..1542822 (-) 954 WP_255136104.1 thioredoxin-disulfide reductase -
  STCNRZ760_RS08080 (STCNRZ760_08010) - 1542855..1543079 (-) 225 WP_002951743.1 DUF4059 family protein -
  STCNRZ760_RS08085 (STCNRZ760_08015) - 1543294..1544037 (-) 744 WP_011226469.1 amino acid ABC transporter ATP-binding protein -
  STCNRZ760_RS08090 (STCNRZ760_08020) - 1544037..1544783 (-) 747 WP_180481337.1 amino acid ABC transporter permease -
  STCNRZ760_RS08095 (STCNRZ760_08025) - 1545180..1546010 (-) 831 WP_041828322.1 transporter substrate-binding domain-containing protein -
  STCNRZ760_RS08100 (STCNRZ760_08030) - 1546480..1546713 (-) 234 WP_180481093.1 hypothetical protein -
  STCNRZ760_RS08105 (STCNRZ760_08035) dinB 1547023..1548126 (-) 1104 WP_164178282.1 DNA polymerase IV -
  STCNRZ760_RS08110 (STCNRZ760_08040) pflB 1548405..1550714 (+) 2310 WP_002947035.1 formate C-acetyltransferase -
  STCNRZ760_RS08115 (STCNRZ760_08045) - 1550981..1551763 (+) 783 WP_180481094.1 carbonic anhydrase family protein -
  STCNRZ760_RS08120 (STCNRZ760_08050) - 1551814..1552266 (+) 453 WP_180481095.1 GNAT family N-acetyltransferase -
  STCNRZ760_RS08125 (STCNRZ760_08055) - 1552618..1552923 (-) 306 WP_164178283.1 restriction endonuclease subunit S -
  STCNRZ760_RS08130 (STCNRZ760_08060) mobV 1552948..1553456 (-) 509 Protein_1549 MobV family relaxase -
  STCNRZ760_RS08135 (STCNRZ760_08065) - 1553937..1554526 (-) 590 Protein_1550 site-specific integrase -
  STCNRZ760_RS08140 (STCNRZ760_08070) - 1554614..1555300 (-) 687 WP_180481096.1 hypothetical protein -
  STCNRZ760_RS08145 (STCNRZ760_08075) fetB 1555376..1556131 (-) 756 WP_180481097.1 iron export ABC transporter permease subunit FetB -
  STCNRZ760_RS08150 (STCNRZ760_08080) - 1556128..1556778 (-) 651 WP_180478205.1 ATP-binding cassette domain-containing protein -
  STCNRZ760_RS08155 (STCNRZ760_08085) - 1556980..1557936 (-) 957 WP_002951776.1 serine hydrolase domain-containing protein -
  STCNRZ760_RS08160 (STCNRZ760_08090) - 1557936..1558691 (-) 756 WP_011681560.1 CppA family protein -
  STCNRZ760_RS08165 (STCNRZ760_08095) - 1558974..1559249 (+) 276 WP_224103608.1 CPBP family intramembrane glutamic endopeptidase -
  STCNRZ760_RS08170 (STCNRZ760_08100) gla 1559423..1560286 (-) 864 WP_002951781.1 aquaglyceroporin Gla -
  STCNRZ760_RS08175 (STCNRZ760_08105) - 1560407..1562674 (+) 2268 WP_180481098.1 Xaa-Pro dipeptidyl-peptidase -
  STCNRZ760_RS08180 (STCNRZ760_08110) - 1562754..1563134 (-) 381 WP_002951783.1 hypothetical protein -
  STCNRZ760_RS08185 (STCNRZ760_08115) - 1563259..1563522 (-) 264 WP_002945924.1 hypothetical protein -
  STCNRZ760_RS08190 (STCNRZ760_08120) - 1563844..1564083 (-) 240 WP_224103609.1 bacteriocin immunity protein -
  STCNRZ760_RS08195 (STCNRZ760_08125) - 1564305..1565231 (-) 927 WP_180481338.1 thioredoxin family protein -
  STCNRZ760_RS08200 (STCNRZ760_08130) - 1565425..1566995 (+) 1571 WP_180481099.1 IS3-like element ISSth1b family transposase -
  STCNRZ760_RS08205 (STCNRZ760_08135) - 1567141..1567395 (-) 255 WP_054571825.1 Blp family class II bacteriocin -
  STCNRZ760_RS08210 - 1567646..1568047 (-) 402 WP_011226490.1 hypothetical protein -
  STCNRZ760_RS08215 (STCNRZ760_08140) - 1569015..1569221 (-) 207 WP_084829836.1 bacteriocin class II family protein -
  STCNRZ760_RS08220 (STCNRZ760_08145) - 1569472..1570203 (+) 732 WP_180481100.1 response regulator transcription factor -
  STCNRZ760_RS08225 - 1570740..1571543 (+) 804 WP_224103634.1 ATP-binding protein -
  STCNRZ760_RS08230 (STCNRZ760_08155) - 1571561..1571722 (-) 162 WP_011226496.1 ComC/BlpC family leader-containing pheromone/bacteriocin -
  STCNRZ760_RS08235 (STCNRZ760_08160) - 1571737..1573104 (-) 1368 WP_084829837.1 bacteriocin secretion accessory protein -
  STCNRZ760_RS08240 (STCNRZ760_08165) comA/nlmT 1573120..1575273 (-) 2154 WP_180481101.1 peptide cleavage/export ABC transporter Regulator
  STCNRZ760_RS08245 (STCNRZ760_08170) - 1576287..1578032 (-) 1746 WP_180481102.1 ABC transporter ATP-binding protein -
  STCNRZ760_RS08250 (STCNRZ760_08175) - 1578025..1579782 (-) 1758 WP_011226502.1 ABC transporter transmembrane domain-containing protein -
  STCNRZ760_RS08255 - 1579970..1580176 (-) 207 WP_002948879.1 hypothetical protein -
  STCNRZ760_RS08260 (STCNRZ760_08185) - 1580381..1580908 (-) 528 WP_180481103.1 VanZ family protein -
  STCNRZ760_RS08265 (STCNRZ760_08190) rlmN 1580910..1582079 (-) 1170 WP_011226504.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  STCNRZ760_RS08270 (STCNRZ760_08195) - 1582083..1582805 (-) 723 WP_180481104.1 YutD family protein -
  STCNRZ760_RS08275 (STCNRZ760_08200) - 1582860..1584215 (-) 1356 WP_059257451.1 metallophosphatase -
  STCNRZ760_RS08280 (STCNRZ760_08210) - 1585064..1586407 (-) 1344 WP_002948888.1 DEAD/DEAH box helicase -
  STCNRZ760_RS08285 (STCNRZ760_08215) mraY 1586482..1587504 (-) 1023 WP_011227524.1 phospho-N-acetylmuramoyl-pentapeptide- transferase -
  STCNRZ760_RS08290 (STCNRZ760_08220) pbp2X 1587506..1589773 (-) 2268 WP_180481105.1 penicillin-binding protein PBP2X -
  STCNRZ760_RS08295 (STCNRZ760_08225) ftsL 1589777..1590097 (-) 321 WP_002948801.1 cell division protein FtsL -
  STCNRZ760_RS08300 (STCNRZ760_08230) rsmH 1590100..1591050 (-) 951 WP_002888254.1 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH -
  STCNRZ760_RS08305 - 1591215..1592207 (-) 993 WP_224103635.1 hypothetical protein -
  STCNRZ760_RS08310 (STCNRZ760_08245) - 1592275..1592538 (+) 264 WP_180481106.1 hypothetical protein -
  STCNRZ760_RS08315 - 1592844..1593199 (-) 356 Protein_1586 DUF805 domain-containing protein -
  STCNRZ760_RS08320 (STCNRZ760_08250) - 1594044..1595294 (-) 1251 WP_173940648.1 glutamate-5-semialdehyde dehydrogenase -
  STCNRZ760_RS08325 (STCNRZ760_08255) proB 1595296..1596099 (-) 804 WP_002948808.1 glutamate 5-kinase -
  STCNRZ760_RS08330 (STCNRZ760_08260) - 1596220..1597809 (-) 1590 WP_180481107.1 ABC transporter permease -
  STCNRZ760_RS08335 (STCNRZ760_08265) - 1597812..1598381 (-) 570 Protein_1590 ABC transporter ATP-binding protein -
  STCNRZ760_RS08340 (STCNRZ760_08270) - 1598572..1599305 (+) 734 Protein_1591 DUF554 domain-containing protein -
  STCNRZ760_RS08345 (STCNRZ760_08275) addA 1599699..1603352 (-) 3654 WP_180481108.1 helicase-exonuclease AddAB subunit AddA -

Sequence

Protein


Download         Length: 358 a.a.        Molecular weight: 39202.09 Da        Isoelectric Point: 9.4944

>NTDB_id=510327 STCNRZ760_RS08060 WP_022096499.1 1539594..1540670(-) (sepM) [Streptococcus thermophilus strain CNRZ760]
MANKTKSKSLLEKMWRIKWWLLSIFTVLFLLFALFFPLNNYYVELPGGAFDTKEVLTVNKKADDSKGSYNFVAVAQTKAT
LALMLYAQFNDFAKLQTAEEATGNYSDEDFMRINQFYMETSQNQAVYQGLTLAGKEVSLEYMGVYVLQVADDSSFKGVLN
IADTVTAVNGKTFDNSTDMIKYVQGLKLGSKVKVTYMRDGKEKTATGKIIKIANGKNGIGIGLTDHTEIKSPENVKFKLD
GVGGPSAGLMFTLAIYDQVSGQDLKAGRKIAGTGTIEKDGAVGDIGGAYLKVKSAADSGADIFFVPNNLVTKEMKKADPD
AKTNYQEAKEAAEKLGTKMKIVPVKTAQEAIDYLKKTK

Nucleotide


Download         Length: 1077 bp        

>NTDB_id=510327 STCNRZ760_RS08060 WP_022096499.1 1539594..1540670(-) (sepM) [Streptococcus thermophilus strain CNRZ760]
GTGGCAAACAAGACAAAATCTAAATCGCTATTAGAGAAAATGTGGCGTATTAAGTGGTGGTTATTAAGTATTTTTACGGT
ACTTTTCCTCCTTTTTGCCCTCTTTTTCCCGCTCAATAATTACTATGTGGAGCTTCCGGGTGGTGCTTTTGATACCAAGG
AAGTCTTGACAGTGAATAAGAAAGCTGATGATTCTAAGGGCTCCTATAATTTTGTGGCGGTGGCTCAAACCAAGGCGACT
TTGGCCTTGATGCTCTATGCTCAGTTTAATGATTTTGCAAAGCTTCAAACGGCTGAAGAGGCAACTGGAAATTACTCTGA
TGAAGATTTCATGCGCATCAACCAATTTTACATGGAGACTTCTCAAAACCAAGCGGTTTATCAGGGCTTGACTCTGGCTG
GTAAGGAGGTTAGTTTGGAGTATATGGGTGTCTATGTGCTTCAGGTTGCTGATGATTCTAGCTTCAAGGGTGTCCTCAAT
ATTGCTGATACGGTGACGGCTGTTAATGGTAAGACCTTTGATAATTCTACTGACATGATTAAATACGTTCAAGGACTTAA
GCTGGGTTCAAAGGTCAAGGTCACTTATATGAGAGATGGCAAAGAAAAGACTGCTACTGGTAAGATTATTAAGATTGCCA
ATGGCAAAAATGGTATTGGTATCGGCCTAACGGACCATACTGAGATCAAGAGTCCTGAGAATGTTAAGTTTAAACTGGAT
GGTGTCGGTGGGCCAAGTGCTGGTCTTATGTTTACCTTGGCTATTTACGATCAGGTGTCTGGTCAAGACCTCAAGGCTGG
CCGCAAGATTGCTGGTACAGGAACTATTGAAAAAGATGGGGCTGTCGGTGATATCGGTGGGGCCTATCTCAAGGTGAAAT
CTGCGGCTGATAGTGGCGCAGACATTTTCTTCGTGCCAAATAATCTAGTAACTAAGGAAATGAAAAAGGCTGATCCGGAT
GCCAAGACTAATTATCAAGAGGCCAAGGAAGCTGCCGAGAAACTGGGGACCAAGATGAAAATCGTCCCTGTTAAAACAGC
TCAAGAAGCCATTGATTATTTGAAAAAGACTAAATGA

Domains

Predicted by InterproScan.

PDZ domain (PDZ_2)

(137-206)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sepM Streptococcus mutans UA159

63.05

95.251

0.601