Detailed information    

insolico Bioinformatically predicted

Overview

Name   pilE   Type   Machinery gene
Locus tag   I3K84_RS22550 Genome accession   NZ_CP065406
Coordinates   2913857..2914006 (+) Length   49 a.a.
NCBI ID   WP_370567830.1    Uniprot ID   -
Organism   Diaphorobacter sp. JS3051     
Function   assembly of type IV pilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2908857..2919006
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I3K84_RS13885 (I3K84_13885) - 2909653..2910468 (+) 816 WP_088888075.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  I3K84_RS13890 (I3K84_13890) - 2910573..2911208 (+) 636 WP_196994785.1 FHA domain-containing protein -
  I3K84_RS13895 (I3K84_13895) - 2911552..2911707 (+) 156 Protein_2767 prepilin-type N-terminal cleavage/methylation domain-containing protein -
  I3K84_RS13900 (I3K84_13900) - 2911773..2912735 (+) 963 WP_011806097.1 IS5 family transposase -
  I3K84_RS22450 - 2912732..2912860 (+) 129 WP_255352815.1 hypothetical protein -
  I3K84_RS22545 (I3K84_13905) - 2912939..2913319 (+) 381 WP_196994786.1 pilin -
  I3K84_RS22495 (I3K84_13910) - 2913441..2913785 (+) 345 WP_304511169.1 prepilin-type N-terminal cleavage/methylation domain-containing protein -
  I3K84_RS22550 (I3K84_13915) pilE 2913857..2914006 (+) 150 WP_370567830.1 hypothetical protein Machinery gene
  I3K84_RS13920 (I3K84_13920) - 2914026..2914817 (+) 792 WP_196994788.1 pilus assembly protein -
  I3K84_RS13925 (I3K84_13925) moaC 2914989..2915474 (-) 486 WP_196994789.1 cyclic pyranopterin monophosphate synthase MoaC -
  I3K84_RS13930 (I3K84_13930) - 2915634..2915870 (+) 237 Protein_2775 peptidase M48 -
  I3K84_RS13935 (I3K84_13935) - 2916131..2916580 (+) 450 WP_011807119.1 HI0074 family nucleotidyltransferase substrate-binding subunit -
  I3K84_RS13940 (I3K84_13940) - 2916577..2916888 (+) 312 WP_011807118.1 nucleotidyltransferase family protein -
  I3K84_RS13950 (I3K84_13950) moaC 2917050..2917535 (-) 486 WP_196994790.1 cyclic pyranopterin monophosphate synthase MoaC -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5057.67 Da        Isoelectric Point: 5.9979

>NTDB_id=509225 I3K84_RS22550 WP_370567830.1 2913857..2914006(+) (pilE) [Diaphorobacter sp. JS3051]
MNNAAPTAASNESIDWACAGNTSITATTRGMTNVTLGTLPAKYLPAECR

Nucleotide


Download         Length: 150 bp        

>NTDB_id=509225 I3K84_RS22550 WP_370567830.1 2913857..2914006(+) (pilE) [Diaphorobacter sp. JS3051]
GTGAACAATGCTGCGCCTACTGCCGCCTCCAATGAGTCTATCGATTGGGCCTGCGCGGGGAATACGTCAATAACTGCTAC
AACGCGCGGCATGACCAATGTGACGCTAGGCACCCTACCGGCCAAATACCTGCCCGCTGAGTGCCGCTGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilE Neisseria elongata subsp. glycolytica ATCC 29315

50.98

100

0.531