Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   I3J23_RS11725 Genome accession   NZ_CP065159
Coordinates   2281903..2282022 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus amyloliquefaciens strain GXU-1     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 2276903..2287022
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I3J23_RS11710 (I3J23_11710) - 2278515..2279198 (+) 684 WP_003156341.1 response regulator transcription factor -
  I3J23_RS11715 (I3J23_11715) - 2279185..2280618 (+) 1434 WP_161625271.1 HAMP domain-containing sensor histidine kinase -
  I3J23_RS11720 (I3J23_11720) rapC 2280771..2281919 (+) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  I3J23_RS11725 (I3J23_11725) phrC 2281903..2282022 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  I3J23_RS11730 (I3J23_11730) - 2282173..2282268 (-) 96 WP_012116800.1 YjcZ family sporulation protein -
  I3J23_RS11735 (I3J23_11735) - 2282363..2283727 (-) 1365 WP_060657805.1 aspartate kinase -
  I3J23_RS11740 (I3J23_11740) ceuB 2284142..2285095 (+) 954 WP_046559346.1 ABC transporter permease Machinery gene
  I3J23_RS11745 (I3J23_11745) - 2285085..2286032 (+) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  I3J23_RS11750 (I3J23_11750) - 2286026..2286784 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=507554 I3J23_RS11725 WP_003156334.1 2281903..2282022(+) (phrC) [Bacillus amyloliquefaciens strain GXU-1]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=507554 I3J23_RS11725 WP_003156334.1 2281903..2282022(+) (phrC) [Bacillus amyloliquefaciens strain GXU-1]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718