Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   IRJ20_RS11770 Genome accession   NZ_CP065137
Coordinates   2344341..2344460 (+) Length   39 a.a.
NCBI ID   WP_031378677.1    Uniprot ID   -
Organism   Bacillus sp. A1(2020)     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 2339341..2349460
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IRJ20_RS11755 - 2340964..2341647 (+) 684 WP_007410267.1 response regulator transcription factor -
  IRJ20_RS11760 - 2341634..2343067 (+) 1434 WP_162303988.1 HAMP domain-containing sensor histidine kinase -
  IRJ20_RS11765 rapC 2343209..2344357 (+) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  IRJ20_RS11770 phrC 2344341..2344460 (+) 120 WP_031378677.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  IRJ20_RS11775 - 2344609..2344704 (-) 96 WP_012116800.1 YjcZ family sporulation protein -
  IRJ20_RS11780 - 2344799..2346163 (-) 1365 WP_042634827.1 aspartate kinase -
  IRJ20_RS11785 ceuB 2346577..2347530 (+) 954 WP_015239156.1 ABC transporter permease Machinery gene
  IRJ20_RS11790 - 2347520..2348467 (+) 948 WP_040238557.1 iron chelate uptake ABC transporter family permease subunit -
  IRJ20_RS11795 - 2348461..2349219 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4240.97 Da        Isoelectric Point: 8.0284

>NTDB_id=507240 IRJ20_RS11770 WP_031378677.1 2344341..2344460(+) (phrC) [Bacillus sp. A1(2020)]
MKLKSKWFVICLAAAAIFTVTGAGQPDQADFHVTERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=507240 IRJ20_RS11770 WP_031378677.1 2344341..2344460(+) (phrC) [Bacillus sp. A1(2020)]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGCCAGA
TCAGGCTGACTTCCATGTAACTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

75

100

0.769