Detailed information NTG0505904

Bioinformatically predicted

Overview

• Name: degQ
• Type: Regulator
• Locus tag: ICC24_RS17390
• Genome accession: NZ_CP065029
• Coordinates: 3328757..3328897 (-)
• Length: 46 a.a.
• NCBI ID: WP_003184860.1
• Uniprot ID: P69890
• Organism: Bacillus licheniformis strain LCDD6
• Function: modification of regulators (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
IS/Tn	3327302..3328732	3328757..3328897	flank	25

Gene organization within MGE regions

Location: 3327302..3328897

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ICC24_RS17385 (ICC24_17385)	-	3327302..3328732 (+)	1431	WP_016886315.1	IS1182 family transposase	-
ICC24_RS17390 (ICC24_17390)	degQ	3328757..3328897 (-)	141	WP_003184860.1	degradation enzyme regulation protein DegQ	Regulator

Sequence

Protein

• Length: 46 a.a.
• Molecular weight: 5747.56 Da
• Isoelectric Point: 8.4596

>NTDB_id=505904 ICC24_RS17390 WP_003184860.1 3328757..3328897(-) (degQ) [Bacillus licheniformis strain LCDD6]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide

• Length: 141 bp

>NTDB_id=505904 ICC24_RS17390 WP_003184860.1 3328757..3328897(-) (degQ) [Bacillus licheniformis strain LCDD6]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATTTAAAAACCTCGTAA

Domains

Predicted by InterproScan.

• DegQ (SacQ) family (DegQ) (1-46)

3D structure

• AlphaFold DB: P69890

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
degQ	Bacillus subtilis subsp. subtilis str. 168	71.429	91.304	0.652