Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   ICC24_RS13480 Genome accession   NZ_CP065029
Coordinates   2606098..2606274 (+) Length   58 a.a.
NCBI ID   WP_003183444.1    Uniprot ID   -
Organism   Bacillus licheniformis strain LCDD6     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2601098..2611274
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ICC24_RS13465 (ICC24_13465) gcvT 2601740..2602834 (-) 1095 WP_003183436.1 glycine cleavage system aminomethyltransferase GcvT -
  ICC24_RS13470 (ICC24_13470) - 2603427..2605106 (+) 1680 WP_003183439.1 DEAD/DEAH box helicase -
  ICC24_RS13475 (ICC24_13475) - 2605113..2605907 (+) 795 WP_003183441.1 YqhG family protein -
  ICC24_RS13480 (ICC24_13480) sinI 2606098..2606274 (+) 177 WP_003183444.1 anti-repressor SinI Regulator
  ICC24_RS13485 (ICC24_13485) sinR 2606308..2606643 (+) 336 WP_006637528.1 transcriptional regulator SinR Regulator
  ICC24_RS13490 (ICC24_13490) tasA 2606748..2607542 (-) 795 WP_003183447.1 biofilm matrix protein TasA -
  ICC24_RS13495 (ICC24_13495) sipW 2607616..2608200 (-) 585 WP_003183449.1 signal peptidase I SipW -
  ICC24_RS13500 (ICC24_13500) tapA 2608197..2608925 (-) 729 WP_011198112.1 amyloid fiber anchoring/assembly protein TapA -
  ICC24_RS13505 (ICC24_13505) - 2609202..2609522 (+) 321 WP_003183454.1 YqzG/YhdC family protein -
  ICC24_RS13510 (ICC24_13510) - 2609552..2609734 (-) 183 WP_003183456.1 YqzE family protein -
  ICC24_RS13515 (ICC24_13515) comGG 2609823..2610188 (-) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  ICC24_RS13520 (ICC24_13520) comGF 2610201..2610689 (-) 489 WP_011201694.1 competence type IV pilus minor pilin ComGF -
  ICC24_RS13525 (ICC24_13525) comGE 2610598..2610945 (-) 348 WP_026699160.1 competence type IV pilus minor pilin ComGE -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6724.47 Da        Isoelectric Point: 4.7616

>NTDB_id=505888 ICC24_RS13480 WP_003183444.1 2606098..2606274(+) (sinI) [Bacillus licheniformis strain LCDD6]
MNKDKNEKEELDEEWTDLIKHALEQGISPEEIRIFLNLGKKSSNPSTSIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=505888 ICC24_RS13480 WP_003183444.1 2606098..2606274(+) (sinI) [Bacillus licheniformis strain LCDD6]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGACTTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGAAATACGTATTTTTCTCAATTTGGGAAAGAAGTCTTCAAATCCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

51.724

100

0.517