Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   IXY25_RS17265 Genome accession   NZ_CP064846
Coordinates   3481403..3481543 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain BZR 86     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3476403..3486543
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IXY25_RS17240 (IXY25_17055) - 3476709..3477107 (+) 399 WP_003152031.1 YueI family protein -
  IXY25_RS17245 (IXY25_17060) - 3477204..3477755 (+) 552 WP_003152033.1 cysteine hydrolase family protein -
  IXY25_RS17250 (IXY25_17065) - 3477773..3479239 (+) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  IXY25_RS17255 (IXY25_17070) - 3479369..3480589 (+) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  IXY25_RS17260 (IXY25_17075) - 3480596..3480937 (-) 342 WP_003152040.1 hypothetical protein -
  IXY25_RS17265 (IXY25_17080) degQ 3481403..3481543 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  IXY25_RS17270 (IXY25_17085) comQ 3481728..3482660 (+) 933 WP_050560672.1 class 1 isoprenoid biosynthesis enzyme Regulator
  IXY25_RS17275 (IXY25_17095) comP 3482813..3485116 (+) 2304 WP_003152050.1 histidine kinase Regulator
  IXY25_RS17280 (IXY25_17100) comA 3485197..3485841 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  IXY25_RS17285 (IXY25_17105) - 3485863..3486246 (+) 384 WP_003152054.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=505309 IXY25_RS17265 WP_003152043.1 3481403..3481543(+) (degQ) [Bacillus velezensis strain BZR 86]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=505309 IXY25_RS17265 WP_003152043.1 3481403..3481543(+) (degQ) [Bacillus velezensis strain BZR 86]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891