Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | IXY25_RS17265 | Genome accession | NZ_CP064846 |
| Coordinates | 3481403..3481543 (+) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain BZR 86 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3476403..3486543
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IXY25_RS17240 (IXY25_17055) | - | 3476709..3477107 (+) | 399 | WP_003152031.1 | YueI family protein | - |
| IXY25_RS17245 (IXY25_17060) | - | 3477204..3477755 (+) | 552 | WP_003152033.1 | cysteine hydrolase family protein | - |
| IXY25_RS17250 (IXY25_17065) | - | 3477773..3479239 (+) | 1467 | WP_014305722.1 | nicotinate phosphoribosyltransferase | - |
| IXY25_RS17255 (IXY25_17070) | - | 3479369..3480589 (+) | 1221 | WP_003152038.1 | EAL and HDOD domain-containing protein | - |
| IXY25_RS17260 (IXY25_17075) | - | 3480596..3480937 (-) | 342 | WP_003152040.1 | hypothetical protein | - |
| IXY25_RS17265 (IXY25_17080) | degQ | 3481403..3481543 (+) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| IXY25_RS17270 (IXY25_17085) | comQ | 3481728..3482660 (+) | 933 | WP_050560672.1 | class 1 isoprenoid biosynthesis enzyme | Regulator |
| IXY25_RS17275 (IXY25_17095) | comP | 3482813..3485116 (+) | 2304 | WP_003152050.1 | histidine kinase | Regulator |
| IXY25_RS17280 (IXY25_17100) | comA | 3485197..3485841 (+) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| IXY25_RS17285 (IXY25_17105) | - | 3485863..3486246 (+) | 384 | WP_003152054.1 | hotdog fold thioesterase | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=505309 IXY25_RS17265 WP_003152043.1 3481403..3481543(+) (degQ) [Bacillus velezensis strain BZR 86]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=505309 IXY25_RS17265 WP_003152043.1 3481403..3481543(+) (degQ) [Bacillus velezensis strain BZR 86]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |