Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   IXY25_RS10755 Genome accession   NZ_CP064846
Coordinates   2209387..2209506 (-) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain BZR 86     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 2204387..2214506
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IXY25_RS10730 (IXY25_10610) - 2204626..2205384 (-) 759 WP_003156330.1 ABC transporter ATP-binding protein -
  IXY25_RS10735 (IXY25_10615) - 2205378..2206325 (-) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  IXY25_RS10740 (IXY25_10620) ceuB 2206315..2207268 (-) 954 WP_003156332.1 ABC transporter permease Machinery gene
  IXY25_RS10745 (IXY25_10625) - 2207683..2209047 (+) 1365 WP_003156333.1 aspartate kinase -
  IXY25_RS10750 (IXY25_10630) - 2209127..2209237 (+) 111 WP_369719092.1 YjcZ family sporulation protein -
  IXY25_RS10755 (IXY25_10635) phrC 2209387..2209506 (-) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  IXY25_RS10760 (IXY25_10640) rapC 2209490..2210638 (-) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  IXY25_RS10765 (IXY25_10645) - 2210791..2212224 (-) 1434 WP_162130794.1 HAMP domain-containing sensor histidine kinase -
  IXY25_RS10770 (IXY25_10650) - 2212211..2212894 (-) 684 WP_003156341.1 response regulator transcription factor -

Sequence

Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=505285 IXY25_RS10755 WP_003156334.1 2209387..2209506(-) (phrC) [Bacillus velezensis strain BZR 86]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=505285 IXY25_RS10755 WP_003156334.1 2209387..2209506(-) (phrC) [Bacillus velezensis strain BZR 86]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-39)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718